Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.87
PubTator Score 3.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 3.2e-03
astrocytic glioma -2.400 2.0e-02
atypical teratoid / rhabdoid tumor -2.100 5.2e-04
Breast cancer 1.200 4.6e-07
glioblastoma -1.300 7.3e-04
hereditary spastic paraplegia -1.140 4.2e-03
intraductal papillary-mucinous carcinoma... 1.100 1.8e-03
intraductal papillary-mucinous neoplasm ... 1.500 7.4e-04
medulloblastoma, large-cell -2.200 1.0e-04
oligodendroglioma -1.100 5.1e-10
osteosarcoma -2.298 9.0e-06
pancreatic ductal adenocarcinoma liver m... -1.069 1.4e-02
Pick disease -1.400 1.4e-03
pituitary cancer 1.100 2.1e-05
Polycystic ovary syndrome 1.053 6.5e-03
psoriasis -1.100 6.4e-04
ulcerative colitis -1.100 2.7e-03

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG      1 - 70
RVTPKEWRNQ                                                                 71 - 80
//

Text Mined References (13)

PMID Year Title