Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.69
PubTator Score 3.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P24311 B2R4M3 Q6ICR1
Symbols APLCC
LSDMCA2

Gene

Gene RIF (4)

PMID Text
23122588 study analyzed the X-linked COX7B and found deleterious de novo mutations in two simplex cases of microphthalmia with linear skin lesions and a nonsense mutation, which segregates with the disease, in a familial case
22860893 Data indicate that recombinant (r)IL-24 stimulated the mitochondrial apoptotic pathway genes Bax, Bid, Casp8, COX6C, COX7B after 36 h.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20307258 Novel insights into the assembly and function of human nuclear-encoded cytochrome c oxidase subunits 7b

AA Sequence

MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG      1 - 70
RVTPKEWRNQ                                                                 71 - 80
//

Text Mined References (13)

PMID Year Title
23122588 2012 Mutations in COX7B cause microphthalmia with linear skin lesions, an unconventional mitochondrial disease.
22860893 2013 Interleukin-24 mediates apoptosis in human B-cells through early activation of cell cycle arrest followed by late induction of the mitochondrial apoptosis pathway.
20307258 2010 Novel insights into the assembly and function of human nuclear-encoded cytochrome c oxidase subunits 4, 5a, 6a, 7a and 7b.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9752724 1998 Structural organization and transcription regulation of nuclear genes encoding the mammalian cytochrome c oxidase complex.
9660196 1998 Assembly of cytochrome-c oxidase in cultured human cells.
8781533 1996 Biochemical analysis of fibroblasts from patients with cytochrome c oxidase-associated Leigh syndrome.
More...