Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.48
PubTator Score 20.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.191 4.4e-02
adult high grade glioma -2.000 3.5e-03
astrocytic glioma -2.600 7.0e-03
Astrocytoma, Pilocytic -2.300 1.5e-06
atypical teratoid / rhabdoid tumor -3.800 7.2e-11
Breast cancer -1.400 7.5e-05
breast carcinoma -2.200 1.3e-04
colon cancer -2.200 1.1e-02
ductal carcinoma in situ -2.400 1.6e-04
ependymoma -3.000 8.7e-03
fibroadenoma -2.100 8.8e-03
glioblastoma -2.000 1.4e-05
group 3 medulloblastoma -2.300 1.1e-03
intraductal papillary-mucinous adenoma (... -3.000 1.0e-05
intraductal papillary-mucinous carcinoma... -3.000 4.7e-05
intraductal papillary-mucinous neoplasm ... -3.100 3.0e-04
invasive ductal carcinoma -3.200 2.8e-04
lung adenocarcinoma -2.000 5.8e-09
lung cancer -1.800 3.1e-03
medulloblastoma, large-cell -4.200 6.5e-08
non-small cell lung cancer -2.122 2.8e-25
oligodendroglioma -2.000 6.9e-15
primary Sjogren syndrome -1.300 3.0e-02
primitive neuroectodermal tumor -3.500 1.8e-06
psoriasis -1.100 2.9e-03
spina bifida -1.474 2.3e-02

 GWAS Trait (1)

Gene RIF (10)

AA Sequence

MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYS      1 - 70
LGWASFPRN                                                                  71 - 79
//

Text Mined References (22)

PMID Year Title