Property Summary

NCBI Gene PubMed Count 21
PubMed Score 20.28
PubTator Score 20.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Senile Plaques 3
Disease Target Count P-value
non-small cell lung cancer 2798 2.8214815038266E-25
oligodendroglioma 2849 6.86801596296244E-15
lung adenocarcinoma 2714 3.97007677351083E-13
atypical teratoid / rhabdoid tumor 4369 7.15379403592871E-11
medulloblastoma, large-cell 6234 6.50265997337742E-8
medulloblastoma 1524 1.40437978512144E-7
glioblastoma 5572 1.71487788870877E-7
pediatric high grade glioma 2712 2.43246110628557E-7
pilocytic astrocytoma 3086 7.24551193326962E-7
primitive neuroectodermal tumor 3031 1.83748249036433E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 1.01015702462143E-5
lung cancer 4473 2.43494519905898E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.74697037728623E-5
breast carcinoma 1614 1.25498588984615E-4
ductal carcinoma in situ 1745 1.6243311743611E-4
invasive ductal carcinoma 2950 2.82360057342786E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.97244451004039E-4
psoriasis 6685 0.00285206647792915
ependymoma 2514 0.00873833303616752
fibroadenoma 557 0.00881945637433638
colon cancer 1475 0.0106483692197268
astrocytoma 1493 0.0111797528511884
inflammatory breast cancer 404 0.0157532085340336
spina bifida 1064 0.023490066253687
primary Sjogren syndrome 789 0.029664338082942
adrenocortical carcinoma 1427 0.0436524411087718

Expression

  Differential Expression (26)

Synonym

Accession P24310
Symbols COX7A
COX7AH
COX7AM

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG

 GWAS Trait (1)

Gene RIF (9)

PMID Text
25666558 We demonstrate a developmental isoform switch of COX6A and COX7A subunits in human and mouse skeletal muscle
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19843159 Data found that subunits Cox6a, Cox6b and Cox7a assembled into pre-existing complex IV, while Cox4-1 and Cox6c subunits assembled into subcomplexes that may represent rate-limiting intermediates.
18488190 While DNA methylation of the COX7A1 promoter was increased in muscle from elderly compared with young twins, the opposite was found for COX7A1 mRNA expression
18488190 Observational study of gene-disease association. (HuGE Navigator)
11997101 promoter contains and is regulated by sequence elements typical of contractile muscle as well as the element for the common transcription factor Sp1

AA Sequence

MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYS      1 - 70
LGWASFPRN                                                                  71 - 79
//

Text Mined References (21)

PMID Year Title
25666558 2015 Investigating the role of the physiological isoform switch of cytochrome c oxidase subunits in reversible mitochondrial disease.
22968485 2012 Muscle inflammatory signaling in response to 9 days of physical inactivity in young men with low compared with normal birth weight.
22592081 2012 High-resolution melting analysis of 15 genes in 60 patients with cytochrome-c oxidase deficiency.
22142811 2012 Differentiation-promoting culture of competent and noncompetent keratinocytes identifies biomarkers for head and neck cancer.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20413852 2010 Polymorphic variation in cytochrome oxidase subunit genes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19843159 2009 Assembly of nuclear DNA-encoded subunits into mitochondrial complex IV, and their preferential integration into supercomplex forms in patient mitochondria.
19779253 2009 Diabetes--role of epigenetics, genetics, and physiological factors.
More...