Property Summary

NCBI Gene PubMed Count 110
Grant Count 32
R01 Count 10
Funding $3,663,086.46
PubMed Score 265.17
PubTator Score 1624.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 0.000
non-inflammatory breast cancer -1.300 0.043
psoriasis -1.600 0.000

Gene RIF (94)

PMID Text
26791408 Liver fat content and serum ALT were inversely correlated with bone mineral density in middle-aged and elderly men.
26791191 Data suggest that, in context of abnormal hepatic lipid accumulation in nonalcoholic fatty liver disease, circulating GPT1 rises due to up-regulation of hepatic expression of GPT1 associated with greater gluconeogenesis and insulin resistance.
26664483 Age, female gender, and elevated ALT can help identifying cases with biliary etiology of acute pancreatitis.
26632395 IBS [irritable bowel syndrome ] may be an important condition in certain patients with elevated ALT levels and MS [ metabolic syndrome ].
26446640 Elevated aminotransferase levels, even within the normal range, were significantly associated with increased risk of all external-cause mortalities, including suicide, and injury.
26290281 The serum hepcidin, ferritin, alanine transaminase, aspartate transaminase, gamma-glutamyltransferase and bilirubin were examined in two independent Chinese cohorts consisted of 3455 individuals.
26160405 There are significant relationships of elevated ALT levels with cardiometabolic risk factors (obesity, hypertension, hypercholesteremia, hyperuricemia, hypertriglyceridemia) and several sex-related differences in rural Chinese.
25874513 ALT was significantly associated with elevated levels of triacylglycerols, hyperglycemia, and obesity. In patients with metabolic syndrome, one must consider liver involvement if the patient has ALT levels in the upper third of the reference range.
25543901 Serum glutamate pyruvate transaminase levels were elevated postoperatively in recipients of an orthotopic liver transplant from a brain-dead donor receiving extracorporeal membrane oxygenation.
25437895 elevated serum ALT and GGT levels are associated with increased arterial stiffness, independent of the classical atherosclerotic risk factors in Japanese men
More...

AA Sequence

MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGD      1 - 70
AQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYI     71 - 140
ERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDE    141 - 210
ERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVY    211 - 280
AAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCP    281 - 350
PVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL    351 - 420
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAK    421 - 490
FTLEYS                                                                    491 - 496
//

Text Mined References (112)

PMID Year Title
26791408 2016 The association of liver fat content and serum alanine aminotransferase with bone mineral density in middle-aged and elderly Chinese men and postmenopausal women.
26791191 2016 Serum aminotransferases in nonalcoholic fatty liver disease are a signature of liver metabolic perturbations at the amino acid and Krebs cycle level.
26664483 Clinico-biochemical factors to early predict biliary etiology of acute pancreatitis: age, female gender, and ALT.
26632395 2016 Irritable Bowel Syndrome May Be Associated with Elevated Alanine Aminotransferase and Metabolic Syndrome.
26477546 2015 Joubert Syndrome in French Canadians and Identification of Mutations in CEP104.
26446640 2015 Elevation of Serum Aminotransferase Levels and Future Risk of Death from External Causes: A Prospective Cohort Study in Korea.
26290281 2015 Elevated serum transaminase activities were associated with increased serum levels of iron regulatory hormone hepcidin and hyperferritinemia risk.
26160405 2015 Association between elevated serum alanine aminotransferase and cardiometabolic risk factors in rural Chinese population: a cross-sectional study.
25874513 2015 Redefining the alanine aminotransferase upper limit of normal improves the prediction of metabolic syndrome risk.
25543901 2014 Marked elevation of hepatic transaminases in recipients of an orthotopic liver transplant from a brain-dead donor receiving extracorporeal membrane oxygenation.
More...