Property Summary

NCBI Gene PubMed Count 124
Grant Count 267
R01 Count 123
Funding $41,966,811.59
PubMed Score 2809.85
PubTator Score 1796.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -7.204 0.000

Synonym

Accession P24158 P15637 P18078 Q4VB08 Q4VB09 Q6LBM7 Q6LBN2 Q9UD25 Q9UQD8
Symbols MBN
MBT
NP4
P29
PR3
ACPA
AGP7
NP-4
PR-3
CANCA
C-ANCA

Gene

PANTHER Protein Class (3)

PDB

1FUJ  

Gene RIF (89)

PMID Text
26436651 The PR3-induced microenvironment facilitated recruitment of inflammatory cells, such as macrophages, plasmacytoid DCs (pDCs), and neutrophils, which were observed in close proximity within granulomatous lesions in the lungs of GPA patients.
25927497 ACPA negative rheumatoid arthritis shares the genetic susceptibility loci with ACPA positive disease.
25788529 miR-634 mimics induced a proinflammatory phenotype in monocyte-derived macrophages, with enhanced expression and release of ADAM17 and IL-6 in Proteinase-3 ANCA-Associated Vasculitis
25461407 Data suggest that targeting proteinase-3 (PR3) specific effector memory cells, to prevent relapse, and instituting anti IL-17 therapy, or modulating Tregs could be newer forms of therapy for granulomatosis with polyangiitis (GPA).
25416382 these results highlight a potentially important role for proteinase 3 in emphysema.
25180606 Proteinase 3-mediated caspase-3 activation controls neutrophil spontaneous death
25092677 Circulating protein levels and enzymatic activity of PRTN3 are markedly elevated in patients with type 1 diabetes mellitus, and are correlated with increased autoantibodies against beta-cell antigens.
24993595 The data shows that the neutrophil protease PR3 is a direct modulator of human platelets and causes shape change through activation of the Rho/Rho kinase and Ca(2+) signaling pathways.
24949444 Elevated levels of GCF proteinase 3 in CP, G-AgP, and gingivitis might suggest that proteinase 3 plays a role during inflammatory periodontal events in host response.
24929239 These in vivo data provide, for the first time, compelling evidence of the collateral involvement of cathepsin G, NE, and proteinase 3 in cigarette smoke-induced tissue damage and emphysema
More...

AA Sequence

MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAA      1 - 70
HCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLP     71 - 140
QQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICD    141 - 210
GIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP                            211 - 256
//

Text Mined References (128)

PMID Year Title
26436651 2015 Proteinase 3 on apoptotic cells disrupts immune silencing in autoimmune vasculitis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25927497 2015 Anti-citrullinated peptide/protein antibody (ACPA)-negative RA shares a large proportion of susceptibility loci with ACPA-positive RA: a meta-analysis of genome-wide association study in a Japanese population.
25788529 2015 Circulating ADAM17 Level Reflects Disease Activity in Proteinase-3 ANCA-Associated Vasculitis.
25461407 2015 Predominance of PR3 specific immune response and skewed TH17 vs. T-regulatory milieu in active granulomatosis with polyangiitis.
25416382 2015 ?-1-antitrypsin variants and the proteinase/antiproteinase imbalance in chronic obstructive pulmonary disease.
25180606 2014 Proteinase 3-dependent caspase-3 cleavage modulates neutrophil death and inflammation.
25092677 2014 Increased neutrophil elastase and proteinase 3 and augmented NETosis are closely associated with ?-cell autoimmunity in patients with type 1 diabetes.
24993595 2014 The neutrophil serine protease PR3 induces shape change of platelets via the Rho/Rho kinase and Ca(2+) signaling pathways.
24949444 2014 Are proteinase 3 and cathepsin C enzymes related to pathogenesis of periodontitis?
More...