Property Summary

NCBI Gene PubMed Count 71
PubMed Score 121.87
PubTator Score 197.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
axial spondyloarthropathy 1.400 4.4e-02
COPD -1.200 8.8e-03
gastric cancer -1.100 2.3e-02
lung cancer -1.300 3.1e-03
mucosa-associated lymphoid tissue lympho... 2.526 1.1e-02
non primary Sjogren syndrome sicca -1.200 2.0e-02
psoriasis 1.100 2.0e-12
tuberculosis -2.300 9.3e-04

Gene RIF (46)

AA Sequence

MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYRE      1 - 70
IGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGE     71 - 140
NISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNA    141 - 210
LELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFA    211 - 280
RTPSVCK                                                                   281 - 287
//

Text Mined References (72)

PMID Year Title