Property Summary

NCBI Gene PubMed Count 69
Grant Count 26
R01 Count 21
Funding $1,826,469.11
PubMed Score 117.77
PubTator Score 197.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer -1.400 0.001
tuberculosis -2.300 0.001
lung cancer -1.600 0.004
non primary Sjogren syndrome sicca -1.200 0.020
COPD -1.200 0.009
mucosa-associated lymphoid tissue lympho... 2.526 0.011
axial spondyloarthropathy 1.400 0.044
psoriasis 1.100 0.000

Gene RIF (44)

PMID Text
25907714 Findings suggest a basis for the use of Fc receptor I for IgA (FcalphaRI) as a molecular target for the treatment of lupus.
25339672 induces different forms of neutrophil death, depending on the inflammatory microenvironment
24732061 this study examined the expression of IL-4 mRNA, IFN-c mRNA and FcaRI mRNA in tonsillar mononuclear cells of IgA nephropathy9(IgAN) patients and non-IgAN patients.
21985370 These results suggest a role of anti-FcaRI Fab as a negative regulator in controlling the magnitude of the innate immune response
21866091 Abnormally glycosylated IgA1 and soluble CD89-IgA and IgA-IgG complexes, features of primary IgA nephropathy, are also present in alcoholic cirrhosis.
21784854 Glycosylation of the CH2/CH3 interface inhibits interaction with the pathogen IgA binding protein SSL7, while maintaining binding of pIgR, essential to the biosynthesis and transport of SIgA.
21750160 FCAR polymorphism is not associated with high susceptibility to IGA nephropathy in caucasians.
21653835 In this study, human mammary carcinoma cells are efficiently killed when incubated with human neutrophils and tumor-specific FcalphaRI bispecific or immunoglobulin A antibodies.
21383176 FcalphaRI defines a function for pentraxins in inflammatory responses involving neutrophils and macrophages. It also highlights the innate aspect of otherwise humoral immunity-associated antibody receptors.
21273231 Genetic variation at the promoter region of IgA receptor is associated with IgA nephropathy.
More...

AA Sequence

MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYRE      1 - 70
IGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGE     71 - 140
NISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNA    141 - 210
LELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFA    211 - 280
RTPSVCK                                                                   281 - 287
//

Text Mined References (70)

PMID Year Title
25907714 2015 Targeted IgA Fc receptor I (Fc?RI) therapy in the early intervention and treatment of pristane-induced lupus nephritis in mice.
25339672 2014 Human IgA Fc receptor Fc?RI (CD89) triggers different forms of neutrophil death depending on the inflammatory microenvironment.
24732061 Expression and correlation analysis of IL-4, IFN-? and Fc?RI in tonsillar mononuclear cells in patients with IgA nephropathy.
21985370 2011 Negative regulation of inflammatory responses by immunoglobulin A receptor (Fc?RI) inhibits the development of Toll-like receptor-9 signalling-accelerated glomerulonephritis.
21866091 2011 Both IgA nephropathy and alcoholic cirrhosis feature abnormally glycosylated IgA1 and soluble CD89-IgA and IgG-IgA complexes: common mechanisms for distinct diseases.
21784854 2011 Interaction of human, rat, and mouse immunoglobulin A (IgA) with Staphylococcal superantigen-like 7 (SSL7) decoy protein and leukocyte IgA receptor.
21750160 2012 Single nucleotidic polymorphism 844 A->G of FCAR is not associated with IgA nephropathy in Caucasians.
21653835 2011 Targeting Fc?RI on polymorphonuclear cells induces tumor cell killing through autophagy.
21383176 2011 Recognition and functional activation of the human IgA receptor (FcalphaRI) by C-reactive protein.
21273231 2011 Association of -27T>C and its haplotype at the putative promoter for IgA-specific receptor gene with IgA nephropathy among the Chinese Han population.
More...