Property Summary

NCBI Gene PubMed Count 142
PubMed Score 293.21
PubTator Score 58.21

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P24001 A6NNM0 A8MPX0 B4DJM1 B8Q191 D3DUB0 D3DUB2 Q5VFH7 Q5VFH8 Q8WV38 Q96GK9 IL-32
Symbols NK4
TAIF
TAIFa
TAIFb
TAIFc
TAIFd
IL-32beta
IL-32alpha
IL-32delta
IL-32gamma

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (136)

AA Sequence

MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIER      1 - 70
FYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVED     71 - 140
PATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQ    141 - 210
SYGAPRGDKEELTPQKCSEPQSSK                                                  211 - 234
//

Text Mined References (144)

PMID Year Title