Property Summary

NCBI Gene PubMed Count 129
Grant Count 7
R01 Count 6
Funding $1,209,385.13
PubMed Score 262.88
PubTator Score 58.21

Knowledge Summary

Patent

No data available

Expression

Gene RIF (123)

PMID Text
26678222 This study demonstrates that IL-32gamma and IL-32beta can induce caspase-8-dependent cell death whereas this was not observed for IL-32alpha
26634249 Additional IL-32gamma stimulation in precursor cells enhanced osteoblast differentiation potentially
26551670 High IL32 expression is associated with Sezary syndrome.
26516703 High IL32 expression is associated with acute myeloid leukemia.
26241657 Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failure
26151454 IL-32 is involved in the pathogenesis of airway inflammation.
26144292 highlight some of the potential mechanisms by which the immunomodulatory effect of IL-32 occurs against mycobacterial infections but also areas where mechanistic clarifications are needed
26057774 data further confirms that reduced IL32 methylation is associated with JIA, and that SNPs play an interactive role
25909160 In IL-32alpha-Tg mice, azoxymethane-induced colon cancer incidence was decreased, but expression of TNFR1 and TNFR1-mediated apoptosis was increased. IL-32alpha increased ROS production, prolonging JNK activation. In colon cancer patients, IL-32alpha was increased.
25889282 High IL-32 expression may stimulate the organic metastasis and the lymph node metastasis of colorectal cancer.
More...

AA Sequence

MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIER      1 - 70
FYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVED     71 - 140
PATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQ    141 - 210
SYGAPRGDKEELTPQKCSEPQSSK                                                  211 - 234
//

Text Mined References (131)

PMID Year Title
26678222 2016 Alternatively spliced isoforms of IL-32 differentially influence cell death pathways in cancer cell lines.
26634249 2015 High level of interleukin-32 gamma in the joint of ankylosing spondylitis is associated with osteoblast differentiation.
26551670 2015 Genomic profiling of Sézary syndrome identifies alterations of key T cell signaling and differentiation genes.
26516703 2015 IL-32? gene expression in acute myeloid leukemia suppresses TNF-? production.
26241657 2015 NKP30-B7-H6 Interaction Aggravates Hepatocyte Damage through Up-Regulation of Interleukin-32 Expression in Hepatitis B Virus-Related Acute-On-Chronic Liver Failure.
26151454 2015 Synthetic double-stranded RNA induces interleukin-32 in bronchial epithelial cells.
26144292 2015 The role of interleukin-32 against tuberculosis.
26057774 2015 DNA methylation at IL32 in juvenile idiopathic arthritis.
25909160 2015 IL-32? suppresses colorectal cancer development via TNFR1-mediated death signaling.
25889282 2015 Dysregulation of over-expressed IL-32 in colorectal cancer induces metastasis.
More...