Property Summary

NCBI Gene PubMed Count 183
Grant Count 240
R01 Count 110
Funding $39,103,409.57
PubMed Score 649.16
PubTator Score 558.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (59)

Disease Z-score Confidence
Attention deficit hyperactivity disorder 156 6.491 3.2
Major Depressive Disorder 106 4.918 2.5
Panic disorder 55 4.03 2.0
Oppositional defiant disorder 16 3.713 1.9
Neuroblastoma 78 3.709 1.9
Schizophrenia 501 3.405 1.7
Ocular hyperemia 2 3.127 1.6
Gilles de la Tourette syndrome 47 3.042 1.5
Allergic conjunctivitis 25
Allergic rhinitis 91
Anxiety 24
Atopic dermatitis 944
Binge eating disorder 3
Bipolar affective disorder, current epis... 6 
Carcinoma 2,147 1.0
Cataplexy and narcolepsy 3
Chronic Musculoskeletal Pain 2
Common cold 63
Depressive disorder 48
Diabetic peripheral neuropathy 4
Eustachian Tube Congestion 1
Female stress incontinence 6
Fibromyalgia 22
Generalized anxiety disorder 29
Headache disorder 20
Hypertensive disease 193
Hypertensive disorder 58
Hypotension Secondary to Spinal Anesthes... 2 
Influenza-like symptoms 17
Insomnia 20
Itching of skin 19
Lichen simplex chronicus 7
Life-Threatening Ventricular Tachycardia 15
Low blood pressure 9
Mitral Valve Prolapse Syndrome 3
Mixed anxiety and depressive disorder 10
Narcolepsy 58
Nasal congestion 24
Nasal discharge 26
Nicotine dependence 53
Nocturnal enuresis 6
Obesity 616
Orthostatic intolerance 1
Pain 70
Prevention of Hypotension During Spinal ... 2 
Prevention of Ventricular Fibrillation 2
Rhinitis 46
Seasonal affective disorder 25
Seasonal allergic rhinitis 10
Seizures 95
Severe major depression with psychotic f... 2 
Sinus headache 17
Smoking cessation assistance 8
Social phobia 10
Vasomotor rhinitis 15
Ventricular Fibrillation 10
Ventricular arrhythmia 14
obsessive-compulsive disorder 34
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.326 0.000

Synonym

Accession P23975 B2R707 B4DX48 Q96KH8
Symbols NET
NAT1
NET1
SLC6A5

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity

Gene RIF (199)

PMID Text
26960194 In Major Depressive Disorder patients there seems to be a relationship between the volume of the dorsolateral prefrontal cortex and polymorphism of the SLC6A2 G1287A gene.
26786096 NET undergoes extensive constitutive internalization and internalized NET mainly is sorted to Rab11-positive recycling endosomes.
26678348 Imaging genetic study showed significant differences in NET nondisplaceable binding potential in patients with attention deficit hyperactivity disorder compared to healthy controls, depending on their genotype
26212818 This corticotropin releasing factor-induced regulation on norepinephrine transporter expression and function may play a role in development of stress-related depression and anxiety
26061302 Different combinations of T-182C and the G1287A polymorphisms of NET gene might increase morbidity risk of major depression subpopulations
26051731 NET gene variants are not involved in the etiology of recurrent major depressive disorder in Chinese Han population.
25919853 The rs2242446 genotype, coded additively as the number of minor (G) alleles, significantly predicted both scale scores and count of anxious arousal symptoms but none of the other symptom clusters or severity or probable diagnosis of PTSD.
25831948 polymorphisms of 1287G/A, -182T/C and -3081A/T in the norepinephrine transporter gene are not risk factors in alcohol dependence.
25650523 a NET 182C and 5-HTTLPR polymorphism interaction is associated with susceptibility to treatment resistant depression and ECT treatment response in antidepressant resistant depression patients
25554436 Study identified the haplotype rs36011 (T)/rs1566652 (G) as a novel genetic marker involved in both attention-deficit/hyperactivity disorder disease susceptibility and visual memory
More...

AA Sequence

MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV      1 - 70
GFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYA     71 - 140
VILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPA    141 - 210
AEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVH    211 - 280
GVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSIN    281 - 350
CITSFVSGFAIFSILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAVVFFVMLLALGLDSS    351 - 420
MGGMEAVITGLADDFQVLKRHRKLFTFGVTFSTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAI    421 - 490
GVSWFYGVDRFSNDIQQMMGFRPGLYWRLCWKFVSPAFLLFVVVVSIINFKPLTYDDYIFPPWANWVGWG    491 - 560
IALSSMVLVPIYVIYKFLSTQGSLWERLAYGITPENEHHLVAQRDIRQFQLQHWLAI                 561 - 617
//

Text Mined References (185)

PMID Year Title
26960194 2016 Relationship between G1287A of the NET Gene Polymorphisms and Brain Volume in Major Depressive Disorder: A Voxel-Based MRI Study.
26786096 2016 Differential Internalization Rates and Postendocytic Sorting of the Norepinephrine and Dopamine Transporters Are Controlled by Structural Elements in the N Termini.
26678348 2016 Effects of norepinephrine transporter gene variants on NET binding in ADHD and healthy controls investigated by PET.
26212818 2015 Corticotropin releasing factor up-regulates the expression and function of norepinephrine transporter in SK-N-BE (2) M17 cells.
26061302 2015 A Genetic Susceptibility Mechanism for Major Depression: Combinations of polymorphisms Defined the Risk of Major Depression and Subpopulations.
26051731 2015 Association study between 5-HT2A and NET gene polymorphisms and recurrent major depression disorder in Chinese Han population.
25919853 2015 Association of the rs2242446 polymorphism in the norepinephrine transporter gene SLC6A2 and anxious arousal symptoms of posttraumatic stress disorder.
25831948 2014 [Association between norepinephrine transporter gene polymorphism and alcohol dependence in Japanese].
25650523 2015 Serotonin transporter (5-HTTLPR) and norepinephrine transporter (NET) gene polymorphisms: susceptibility and treatment response of electroconvulsive therapy in treatment resistant depression.
25554436 2015 A haplotype of the norepinephrine transporter gene (SLC6A2) is associated with visual memory in attention-deficit/hyperactivity disorder.
More...