Property Summary

Ligand Count 2,255
NCBI Gene PubMed Count 187
PubMed Score 687.46
PubTator Score 558.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hypertension 396 0.0 0.0
Orthostatic intolerance 1 0.0 0.0
Seizures 596 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
lung cancer 4740 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.326 1.1e-04

 GWAS Trait (1)

Gene RIF (203)

AA Sequence

MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV      1 - 70
GFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYA     71 - 140
VILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPA    141 - 210
AEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVH    211 - 280
GVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSSIN    281 - 350
CITSFVSGFAIFSILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAVVFFVMLLALGLDSS    351 - 420
MGGMEAVITGLADDFQVLKRHRKLFTFGVTFSTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAI    421 - 490
GVSWFYGVDRFSNDIQQMMGFRPGLYWRLCWKFVSPAFLLFVVVVSIINFKPLTYDDYIFPPWANWVGWG    491 - 560
IALSSMVLVPIYVIYKFLSTQGSLWERLAYGITPENEHHLVAQRDIRQFQLQHWLAI                 561 - 617
//

Text Mined References (189)

PMID Year Title