Property Summary

NCBI Gene PubMed Count 109
Grant Count 148
R01 Count 82
Funding $22,798,610.54
PubMed Score 1084.88
PubTator Score 479.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 0.018
psoriasis -1.700 0.007
osteosarcoma -3.271 0.000
Atopic dermatitis -1.300 0.005
ductal carcinoma in situ -1.300 0.001
invasive ductal carcinoma -1.900 0.000

Synonym

Accession P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5
Symbols CYH
MCT1
chymase

Gene

PANTHER Protein Class (3)

PDB

1KLT   1NN6   1PJP   1T31   2HVX   3N7O   3S0N   4AFQ   4AFS   4AFU   4AFZ   4AG1   4AG2   4K2Y   4K5Z   4K60   4K69   4KP0  

Gene RIF (88)

PMID Text
25797204 promoter single nucleotide polymorphism is not associated with Dengue Hemorrhagic Fever and Dengue Shock Syndrome in Vietnam and Philippines
25120737 Our data demonstrated that mast cell chymase plays an important role in keloid formation through TGF-beta1/Smad signaling pathway.
25119908 CMA1 gene single nucleotide polymorphisms is associated with essential hypertension.
25102745 Significant association between the AG genotype of CMA1 A polymorphism and Angina Pectoris and Ventricular Extrasystoles was observed.
24874976 we present data indicating that MC tryptase and chymase contribute to the development of OSF and malignant transformation of the overlying epithelium.
24823657 The polymorphisms and haplotypes of the CMA1 locus are associated with cardiac hypertrophy in male patients with symptomatic aortic stenosis.
24560885 demonstrate the generation of Pso p27 from SCCA1 with extracts from psoriatic scale and even more remarkably, the generation of Pso p27 from SCCA1 in the presence of mast cell associated chymase
24516344 These data suggest a possible contribution of human chymase activation to LPS-induced mortality
24507159 The accumulated data in this review suggest that mast cells, their tryptases, and their chymases play important roles in tissue repair.
24344642 Purified chymase mixed with fragmented heparin derived from heparanase-expressing cells show greater release from collagen gels than the enzyme alone or mixed with macromolecular heparin derived from mock cells.
More...

AA Sequence

MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGR      1 - 70
SITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPP     71 - 140
GRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCA    141 - 210
GVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN                                     211 - 247
//

Text Mined References (112)

PMID Year Title
25797204 2015 Alpha tryptase allele of Tryptase 1 (TPSAB1) gene associated with Dengue Hemorrhagic Fever (DHF) and Dengue Shock Syndrome (DSS) in Vietnam and Philippines.
25120737 2014 Mast cell chymase in keloid induces profibrotic response via transforming growth factor-?1/Smad activation in keloid fibroblasts.
25119908 2014 [Association of CMA1 gene tag single nucleotide polymorphisms with essential hypertension in Yi population from Yunnan].
25102745 2014 [Renin-angiotensin-aldosterone system in hypertrophic cardiomyopathy].
24874976 2014 Altered immunohistochemical expression of mast cell tryptase and chymase in the pathogenesis of oral submucous fibrosis and malignant transformation of the overlying epithelium.
24823657 2014 Association of the common genetic polymorphisms and haplotypes of the chymase gene with left ventricular mass in male patients with symptomatic aortic stenosis.
24560885 2014 Psoriasis pathogenesis - Pso p27 is generated from SCCA1 with chymase.
24516344 2014 Chymase activities and survival in endotoxin-induced human chymase transgenic mice.
24507159 2014 Development of mast cells and importance of their tryptase and chymase serine proteases in inflammation and wound healing.
24344642 2014 Heparanase-mediated cleavage of macromolecular heparin accelerates release of granular components of mast cells from extracellular matrices.
More...