Property Summary

NCBI Gene PubMed Count 244
Grant Count 100
R01 Count 59
Funding $10,129,291.65
PubMed Score 566.12
PubTator Score 738.39

Knowledge Summary

Patent (18,363)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 0.000

Synonym

Accession P23945 A0A0A0MSC5 A8K947 G5CBS7 G5E967 J3KQ00 Q05AH0 Q16225 Q4QRJ3 Q4ZFZ2 Q53RW2 FSH-R
Symbols LGR1
ODG1
FSHR1
FSHRO

Gene

PANTHER Protein Class (1)

PDB

1XWD   4AY9   4MQW   1XUN  

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
504384 confirmatory 4 / 0 / 2 Counterscreen for antagonists of the thyroid stimulating hormone receptor: ELISA activity in a Follicle Stimulating Hormone receptor cell line

Gene RIF (239)

PMID Text
26404793 The role of FSHR gene variants (SNPs in exon 10 (codon 307 and 680) and in the core promoter region (at position -29) and Ala189Val inactivating mutation) in Turkish infertile women
26291798 Ala307Thr polymorphism in FSHR can be potentially associated to primary ovarian insufficiency development and can be considered as a screening marker in patients with ovarian failure signals.
26125757 Our studies further confirmed reports that there were no significant associations between the FSHR Thr307Ala and Asn680Ser polymorphisms and male infertility risk. However, a combined FSHR genotype showed significant association with male infertility.
25935136 The Asn680Ser polymorphism within the FSHR gene was not associated with endometriosis and infertility.
25875778 A novel pathogenic variant in FSHR (c.1253T>G, p.Ile418Ser), inherited as an autosomal recessive trait from heterozygous parents responsible for premature ovarian failure.
25837360 a significant association between Asn680Ser polymorphism of FSHR and polycystic ovary syndrome(Meta-Analysis)
25791375 The extracellular loop 2 (EL2) of FSH receptor (FSHR) plays a pivotal role in various events downstream of FSH stimulation.
25721191 An FSH receptor polymorphism is associated with Clomiphene-resistant anovulation during treatment with clomiphene citrate.
25652007 Endothelial FSHR expression in breast cancer is associated with vascular remodeling at tumor periphery.
25649397 This is the first study to confirm the association of novel LHCGR and FSHR SNPs with PCOS. The differential association of LHCGR and FSHR variants with PCOS confirms the racial/ethnic contribution to their association with PCOS.
More...

AA Sequence

MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFG      1 - 70
DLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHK     71 - 140
IHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELP    141 - 210
NDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFAN    211 - 280
WRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKP    281 - 350
DAFNPCEDIMGYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS    351 - 420
VDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCKVQLRHAASVM    421 - 490
VMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYIHIYLTVRNPN    491 - 560
IVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKAKILLVLFHPINSCANPFLYAIFT    561 - 630
KNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTNGSTYILVPLSHLAQN         631 - 695
//

Text Mined References (251)

PMID Year Title
26404793 2015 Impact of follicle-stimulating hormone receptor variants in female infertility.
26291798 2015 Are FSHR polymorphisms risk factors to premature ovarian insufficiency?
26125757 2015 FSHR gene Thr307Ala and Asn680Ser polymorphisms in infertile men: an association study in North China and meta-analysis.
25935136 2015 LH (Trp8Arg/Ile15Thr), LHR (insLQ) and FSHR (Asn680Ser) polymorphisms genotypic prevalence in women with endometriosis and infertility.
25875778 2015 Novel Inactivating Mutation of the FSH Receptor in Two Siblings of Indian Origin With Premature Ovarian Failure.
25837360 2015 Association between two polymorphisms of follicle stimulating hormone receptor gene and susceptibility to polycystic ovary syndrome: a meta-analysis.
25791375 2015 FSH receptor-specific residues L501 and I505 in extracellular loop 2 are essential for its function.
25721191 2015 Follicle-stimulating hormone receptor polymorphism affects the outcome of ovulation induction in normogonadotropic (World Health Organization class 2) anovulatory subfertility.
25652007 2015 Endothelial follicle-stimulating hormone receptor expression in invasive breast cancer and vascular remodeling at tumor periphery.
25649397 2015 Leutinizing hormone/choriogonadotropin receptor and follicle stimulating hormone receptor gene variants in polycystic ovary syndrome.
More...