Property Summary

Ligand Count 6
NCBI Gene PubMed Count 264
PubMed Score 610.68
PubTator Score 738.39

Knowledge Summary

Patent (18,363)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Ovarian hyperstimulation syndrome 19 5.424 2.7
Ovarian Dysgenesis 1 1 0.0 0.0
Disease Target Count
Ovulation induction 4
Disease Target Count P-value
psoriasis 6694 9.5e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 5.054 2.5
Disease Target Count
46 XX gonadal dysgenesis 5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 9.5e-06

Gene RIF (258)

AA Sequence

MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFG      1 - 70
DLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHK     71 - 140
IHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELP    141 - 210
NDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFAN    211 - 280
WRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKP    281 - 350
DAFNPCEDIMGYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS    351 - 420
VDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCKVQLRHAASVM    421 - 490
VMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYIHIYLTVRNPN    491 - 560
IVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKAKILLVLFHPINSCANPFLYAIFT    561 - 630
KNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTNGSTYILVPLSHLAQN         631 - 695
//

Text Mined References (271)

PMID Year Title