Property Summary

Ligand Count 3
NCBI Gene PubMed Count 122
PubMed Score 662.95
PubTator Score 1416.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0

Expression

  Differential Expression (22)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 4.0e-04
Breast cancer 2.300 3.9e-02
dermatomyositis 1.200 3.2e-04
Endometriosis 1.198 2.6e-02
ependymoma 1.400 6.3e-06
Gaucher disease type 1 -1.400 1.6e-02
glioblastoma 1.100 5.1e-03
group 3 medulloblastoma 2.200 2.3e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.7e-03
lung adenocarcinoma 1.124 1.7e-05
lung cancer 1.300 4.4e-03
medulloblastoma, large-cell 2.200 8.3e-06
non-small cell lung cancer 1.800 7.6e-16
oligodendroglioma 1.200 3.6e-02
osteosarcoma 2.495 2.4e-03
ovarian cancer 2.400 2.1e-05
pediatric high grade glioma 1.400 1.1e-02
primitive neuroectodermal tumor 1.500 1.1e-04
psoriasis 1.400 5.2e-05
subependymal giant cell astrocytoma -1.073 3.7e-02
tuberculosis -1.100 4.7e-06
Waldenstrons macroglobulinemia 1.239 1.6e-02

 MGI Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (100)

AA Sequence

MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTK      1 - 70
HPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRD     71 - 140
FSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGT    141 - 210
NRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYN    211 - 280
NTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSL    281 - 350
MCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL    351 - 420
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPE    421 - 490
ACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSP    491 - 560
VSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVL    561 - 630
SGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGA    631 - 700
FIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEK    701 - 770
ERNTAAMVCSLENRDECLMCGS                                                    771 - 792
//

Text Mined References (127)

PMID Year Title