Property Summary

NCBI Gene PubMed Count 110
PubMed Score 621.84
PubTator Score 1416.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
tuberculosis 1563 4.66857541790084E-6
ependymoma 2514 6.32780024762998E-6
medulloblastoma, large-cell 6234 8.29004753718992E-6
lung adenocarcinoma 2714 1.72579960521497E-5
ovarian cancer 8492 2.06281473625388E-5
group 4 medulloblastoma 1875 2.26005556979832E-5
psoriasis 6685 5.19367104933097E-5
lung cancer 4473 5.19960159842067E-5
atypical teratoid/rhabdoid tumor 1095 1.10166115874777E-4
primitive neuroectodermal tumor 3031 1.10343074181761E-4
dermatomyositis 967 3.21601260999789E-4
osteosarcoma 7933 0.00237376251299895
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00472193041023702
pediatric high grade glioma 2712 0.011334617596627
Gaucher disease type 1 171 0.0161767039985979
Waldenstrons macroglobulinemia 765 0.0162023183630858
Endometriosis 535 0.026389344177218
glioblastoma 5572 0.0330684251767919
oligodendroglioma 2849 0.0357159523184061
subependymal giant cell astrocytoma 2287 0.0367609343719802
Breast cancer 3099 0.039029952909679
Disease Target Count Z-score Confidence
Hemolytic anemia 70 0.0 2.0

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.239 0.016
oligodendroglioma 1.200 0.036
psoriasis 1.400 0.000
glioblastoma 1.400 0.033
osteosarcoma 2.495 0.002
ependymoma 1.400 0.000
group 4 medulloblastoma 2.300 0.000
atypical teratoid/rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 2.200 0.000
primitive neuroectodermal tumor 1.500 0.000
tuberculosis -1.100 0.000
non-small cell lung cancer 1.800 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.005
lung cancer 1.500 0.000
Breast cancer 2.300 0.039
pediatric high grade glioma 1.400 0.011
subependymal giant cell astrocytoma -1.073 0.037
lung adenocarcinoma 1.124 0.000
Endometriosis 1.198 0.026
ovarian cancer 2.400 0.000
Gaucher disease type 1 -1.400 0.016
dermatomyositis 1.200 0.000

Synonym

Accession P23921 Q9UNN2
Symbols R1
RR1
RIR1

Gene

PANTHER Protein Class (2)

PDB

2WGH   3HNC   3HND   3HNE   3HNF   4X3V   5D1Y  

  Ortholog (17)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid
S.cerevisiae OMA EggNOG

 MGI Term (1)

Gene RIF (90)

PMID Text
26828016 Results underline the relevance of microRNA-101-3p-driven regulation of RRM1 in pancreatic ductal carcinoma gemcitabine resistance.
26718430 A significant association has been found between RRM1 rs12806698 (-269C>A) RRM1 genotype and the risk for developing non-small cell lung cancer.
26637889 A possible predictive impact of ribonucleotide-reductase subunit-1 (RRM1) on vinorelbine efficacy in non-small cell lung cancer (NSCLC) has been previously reported.
26323924 The genotype of ribonucleotidereductase M1 -269C > A is associated with the response to platinum-based chemotherapy and as a prognostic biomarker in advanced nonsmall cell lung cancer
26254808 Adenoviral vector expressing short hairpin RNA targeting RRM1 exerts potent antitumor effects and increases sensitivity to gemcitabine.
26252353 TUBB3, TOP2A, CYP19A1 and CYP2D6 gene expression, but not protein expression, was associated with patient survival.
26200905 RRM1 expression was predictive and prognostic of clinical outcome in advanced UC treated with gemcitabine plus platinum combination chemotherapy
26083014 RNA expression of deoxycytidine kinase (DCK), human equilibrative nucleoside transporter-1 (ENT1) and ribonucleotide reductase M1 (RRM1) were significantly higher and cytidine deaminase (CDA) was significantly lower in ex vivo Ara-C sensitive samples.
26028097 For RRM1 C37A-T524C genotype, sensitive group had higher proportion of high effective genotype than non-sensitive group (p=0.009).
25840756 RRM1 expression was identified as independent prognosticators for freedom from recurrence of malignant pleural mesothelioma in patients undergoing induction chemotherapy followed by extrapleural pneumonectomy.
More...

AA Sequence

MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTK      1 - 70
HPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRD     71 - 140
FSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGT    141 - 210
NRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYN    211 - 280
NTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSL    281 - 350
MCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL    351 - 420
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPE    421 - 490
ACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSP    491 - 560
VSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVL    561 - 630
SGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGA    631 - 700
FIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEK    701 - 770
ERNTAAMVCSLENRDECLMCGS                                                    771 - 792
//

Text Mined References (115)

PMID Year Title
26828016 2016 MicroRNA-101-3p reverses gemcitabine resistance by inhibition of ribonucleotide reductase M1 in pancreatic cancer.
26718430 2015 Investigation of some DNA repair genes association in non small cell lung cancer.
26637889 2015 High RRM1 Expression Is Associated with Adverse Outcome in Patients with Cisplatin/Vinorelbine-treated Malignant Pleural Mesothelioma.
26323924 2015 The genotype of ribonucleotidereductase M1 -269C > A is associated with the response to platinum-based chemotherapy and as a prognostic biomarker in advanced nonsmall cell lung cancer.
26254808 2015 Potent effect of adenoviral vector expressing short hairpin RNA targeting ribonucleotide reductase large subunit M1 on cell viability and chemotherapeutic sensitivity to gemcitabine in non-small cell lung cancer cells.
26252353 2015 RRM1, TUBB3, TOP2A, CYP19A1, CYP2D6: Difference between mRNA and protein expression in predicting prognosis of breast cancer patients.
26200905 2015 Predictive and Prognostic Value of Ribonucleotide Reductase Regulatory Subunit M1 and Excision Repair Cross-Complementation Group 1 in Advanced Urothelial Carcinoma (UC) Treated with First-Line Gemcitabine Plus Platinum Combination Chemotherapy.
26083014 2015 RNA expression of genes involved in cytarabine metabolism and transport predicts cytarabine response in acute myeloid leukemia.
26028097 2015 Association of GSTP1 and RRM1 Polymorphisms with the Response and Toxicity of Gemcitabine-cisplatin Combination Chemotherapy in Chinese Patients with Non-small Cell Lung Cancer.
25840756 2015 Importance of excision repair cross-complementation group 1 and ribonucleotide reductase M1 as prognostic biomarkers in malignant pleural mesothelioma treated with platinum-based induction chemotherapy followed by surgery.
More...