Property Summary

NCBI Gene PubMed Count 15
PubMed Score 103.45
PubTator Score 43.49

Knowledge Summary

Patent (12,936)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.14068683479633E-24
atypical teratoid / rhabdoid tumor 4369 1.87742355866624E-7
glioblastoma 5572 1.23402596283066E-6
pediatric high grade glioma 2712 1.65552069917658E-6
medulloblastoma, large-cell 6234 1.80473410477747E-5
group 3 medulloblastoma 2254 3.26991828727424E-5
primitive neuroectodermal tumor 3031 7.27554468664723E-5
osteosarcoma 7933 0.00244791550653517
Disease Target Count Z-score Confidence
Smallpox 20 3.468 1.7
Cowpox 15 3.281 1.6

Expression

  Differential Expression (8)

Synonym

Accession P23919 B7ZW70 Q6FGX1 Q9BUX4
Symbols CDC8
TMPK
TYMK
PP3731

Gene

PANTHER Protein Class (3)

PDB

1E2D   1E2E   1E2F   1E2G   1E2Q   1E98   1E99   1E9A   1E9B   1E9C   1E9D   1E9E   1E9F   1NMX   1NMY   1NMZ   1NN0   1NN1   1NN3   1NN5   2XX3  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
18413751 Lentiviral delivery of small hairpin RNA targeting TMPK in combination with a low dose of doxorubicin as a new approach to kill colon cancer cells regardless of p53 status.

AA Sequence

MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHL      1 - 70
LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADA     71 - 140
AKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL    141 - 210
WK                                                                        211 - 212
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18413751 2008 Synthetic lethality by lentiviral short hairpin RNA silencing of thymidylate kinase and doxorubicin in colon cancer cells regardless of the p53 status.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12614151 2003 Structures of human thymidylate kinase in complex with prodrugs: implications for the structure-based design of novel compounds.
More...