Property Summary

NCBI Gene PubMed Count 15
PubMed Score 105.19
PubTator Score 43.49

Knowledge Summary

Patent (12,936)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.200 3.8e-04
atypical teratoid / rhabdoid tumor 1.100 2.4e-06
glioblastoma 1.400 2.2e-09
group 3 medulloblastoma 1.600 3.3e-05
medulloblastoma, large-cell 1.500 7.6e-05
non-small cell lung cancer 1.354 3.1e-24
osteosarcoma -1.415 2.4e-03
primitive neuroectodermal tumor 1.300 3.4e-04

Synonym

Accession P23919 B7ZW70 Q6FGX1 Q9BUX4
Symbols CDC8
TMPK
TYMK
PP3731

Gene

PANTHER Protein Class (3)

PDB

1E2D   1E2E   1E2F   1E2G   1E2Q   1E98   1E99   1E9A   1E9B   1E9C   1E9D   1E9E   1E9F   1NMX   1NMY   1NMZ   1NN0   1NN1   1NN3   1NN5   2XX3  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHL      1 - 70
LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADA     71 - 140
AKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL    141 - 210
WK                                                                        211 - 212
//

Text Mined References (20)

PMID Year Title