Property Summary

NCBI Gene PubMed Count 269
PubMed Score 1432.11
PubTator Score 575.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hodgkin's lymphoma 11 0.0 2.0
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1170 0.0 5.0

Expression

  Differential Expression (19)

Disease log2 FC p
nephrosclerosis 1.135 5.7e-03
malignant mesothelioma 1.200 2.8e-05
psoriasis -3.000 1.4e-04
cutaneous lupus erythematosus -2.300 3.9e-05
osteosarcoma -2.689 5.3e-08
atypical teratoid / rhabdoid tumor 1.200 2.0e-05
glioblastoma 1.500 9.3e-05
primitive neuroectodermal tumor 2.300 3.6e-02
intraductal papillary-mucinous adenoma (... 1.400 4.9e-02
intraductal papillary-mucinous neoplasm ... 1.400 4.1e-02
lung cancer 3.700 4.3e-06
pancreatic cancer 1.200 3.7e-03
breast carcinoma 1.800 7.8e-05
fibroadenoma 1.700 7.3e-03
interstitial cystitis -4.000 4.7e-06
Breast cancer -2.100 4.4e-06
ductal carcinoma in situ 2.800 1.1e-02
invasive ductal carcinoma 3.500 7.1e-03
pituitary cancer 3.600 4.4e-05

Protein-protein Interaction (4)

Gene RIF (242)

PMID Text
27082299 A high copy number of T-bet and GATA-3 confers susceptibility to AAU and AS, and a high copy number of FOXP3 confers susceptibility to female patients with AAU either with or without AS.
27053161 this study highlights the molecular basis for posttranslational modifications of Gata3 that control the regulation of IFNgamma expression in memory Th2 cells.
27048872 GATA3-mediated positive and negative feedback mechanisms via restraining Notch1 activity control human T-cell lineage commitment.
26922637 These data provide mechanistic insights into GATA3-mediated chromatin reprogramming during MET, and suggest unexpected complexity to transcription factors pioneering
26772397 GATA3 labeling is highest in estrogen receptor-positive carcinomas, it also labels estrogen receptor-negative carcinomas and thus has particular diagnostic utility in the setting of triple-negative breast carcinomas
26719157 Combined marker analysis of GATA3/fascin showed an inverse association and improved prognostic information for patients with breast cancer.
26637396 discuss mutation of GATA3 in breast cancer and the potential mechanism(s) by which mutation may lead to a growth advantage in cancer
26595821 findings demonstrate that GATA3 is expressed in a wide variety of benign and malignant cutaneous epithelial neoplasms
26527523 Immunohistochemical detectionof GATA-3 and FOXA1 expression is useful to differentiate breast carcinoma from other carcinomas.
26514990 Loss-of-function mutation of GATA3 is associated with Hypoparathyroidism, Deafness, and Renal Dysplasia syndrome.
26486740 GATA3 expression levels in luminal breast tumors of advanced stage were significantly higher than that of the HER2 subtype and triple-negative carcinomas, as expected, but were similar to those of the luminal controls.
26313026 As one of the most frequently mutated genes in breast cancer, GATA3 mutations may have an effect on DNA-binding ability, protein production, and transactivation activity
26276775 trefoil factor 1 demonstrated breast specificity but was inferior to mammaglobin and GATA protein binding 3
26274030 GATA3 could be valuable in determining breast origin and in excluding a gynecologic primary.
26135559 GATA3 is a highly sensitive and specific marker for mesonephric lesions in the lower genital tract; however, its utility in the upper genital tract may be more limited.
26028330 GATA3/G9A/NuRD(MTA3) complex inhibits the invasive potential of breast cancer cells in vitro and suppresses breast cancer metastasis in vivo.
25917456 Gata3 interacted with Gcm2 and MafB, two known transcriptional regulators of parathyroid development, and synergistically stimulated the PTH promoter.
25901741 GATA-3 augmentation down-regulates Connexin43 in Helicobacter pylori associated gastric carcinogenesis
25873156 The tested 25 SNPs in TBX21, GATA3, Rorc and Foxp3 did not associate with BD and VKH syndrome.
25855136 rs73635312[A] is associated with susceptibility to cutaneous basal cell carcinoma.
25851711 results support that GATA binding protein 3 immunostain can be a useful tool in differentiating mesonephric lesions from endocervical and endometrial adenocarcinomas
25771973 Identification of a novel GATA3 mutation in a deaf Taiwanese family by massively parallel sequencing
25753145 Western blotting demonstrated GATA3 in choriocarcinoma, whereas the placenta, and cervical and endometrial cancer cell lines, were negative
25651379 overexpression of S100A7 in A431 skin squamous carcinoma cells significantly promoted cell proliferation in vitro and tumor growth in vivo, whereas it suppressed the expression of GATA-3 and caspase-14
25611245 UPII, GATA3, and p40, when used in combination, are highly sensitive in the differential diagnosis of invasive urothelial carcinoma.
25575062 Expressions of GATA-3 in both Th2 polarized gammadeltaT cells and CD4T cells were up-regulated.
25552913 The mRNA level of Th2-specific transcription factor GATA-3 was increased in patients with liver cancer.
25425335 The commonly used breast carcinoma biomarkers vary in their prognostic implications. GCDFP-15 independently indicated a favourable prognosis. GATA-3 and MGB were not associated with outcome.
25410484 In breast cancer, some GATA3 effects shift from tumor suppressing to tumor promoting during tumorigenesis, with deregulation of three genes, BCL2, DACH1, THSD4, representing major GATA3-controlled processes in cancer progression.
25351211 Highlevel GATA3 expression is associated with increased selfrenewal and proliferation of neuroblastoma cells.
25292313 Data show that the expression levels of transcription factors GATA-3 and FOXP3 were upregulated with 1.0 mug/ml galectin-1, while transcription factors TBX21 and RORC expression levels were reduced with both 1.0 and 2.0 mug/ml concentrations of galectin-1.
25258321 ASH2L enhances ERalpha expression as a coactivator of GATA3 in breast cancers
25188865 This study expands the spectrum of neoplasms known to express GATA-3.
25150746 GATA3 is a diagnostically useful marker for triple-negative breast cancer and is more sensitive than MGB and GCDFP15 combined.
25124981 Identified a novel nonsense mutation which will expand the spectrum of HDR-associated GATA3 mutations.
24926087 Strong GATA-3 expression is a reliable marker of primary breast carcinoma in the appropriate clinical context. GATA-3 reactivity in around 70% of triple-negative breast carcinomas is also clinically useful.
24925221 Our novel finding of GATA3 positivity in one-third of bladder small cell carcinoma is of potential value in differentiating small cell carcinomas of prostate origin from those of bladder origin.
24894987 The effect of GATA3 on SPINK5 expression was indirect and GATA3 alone was insufficient for final differentiation of keratinocytes where full SPINK5 expression was observed.
24824028 GATA3 is expressed in most cases of sarcomatoid urothelial carcinoma.
24820417 Data propose that control of GATA3 levels by Fbw7 contributes to the fine-tuning of T-cell development.
24813204 IFN-alpha/beta disrupts the GATA3-autoactivation loop and promotes epigenetic silencing of a Th2-specific regulatory region within the GATA3 gene.
24766459 Study shows the capacity of human CD4(+) and CD8(+) T cells for stable co-expression of GATA-3 and T-bet in humanized mice and reveals a critical role for IL-12 in regulating this phenotype.
24758297 with a similar distribution across the genome, comparing to T47D cells. CONCLUSIONS: We propose that this specific, cancer-derived mutation in GATA3 deregulates physiologic protein turnover, stabilizes GATA3 binding across the genome
24745616 GATA-3 expression differed among urothelial carcinoma variants. GATA-3 is a useful marker for confirming the urothelial origin of micropapillary and plasmacytoid urothelial carcinoma variants but not that of sarcomatoid or small cell carcinoma variants.
24713735 GATA-3 is, so far, the best breast-specific immunomarker, especially when encountering ER-negative metastatic breast carcinomas
24711443 High GATA3 expression is associated with metastatic urothelial carcinoma and distinguishes between metastatic urothelial carcinoma and squamous cell carcinomas.
24660543 Abnormal expression of the transcription factors T-bet and GATA-3 contributes to the imbalance of Thl/Th2 lymphocytes associated with immune dysfunction, leading to the development and progression of aplastic anemia.
24622013 Patients with GATA3 mutation present with early-onset sensorineural hearing loss
24614117 Significant association with alleles of two STAT4 markers and nominal association of Autoimmune Addison's disease with alleles at GATA3, is reported.
24549642 High expression of FOXA1 and GATA3 was significantly associated with improved disease-free survival.
24512009 GATA3 immunohistochemistry is a valuable addition in the discrimination of cystic or oncocytic parathyroid lesions
24504018 GATA3 expression independently predicts an unfavorable prognosis in primary gastric adenocarcinoma patients.
24477928 GATA3 mutations mainly occur in patients with luminal-like breast cancer and have identifiable clinicopathologic and genetic characteristics, highlighting a subgroup of patients with breast cancer in whom limited therapy may be appropriate.
24448324 GATA3 plays an important role in the prevention of bladder cancer progression and metastasis by inhibiting cell migration and invasion as well as epithelial-to-mesenchymal transition.
24434941 Dutch family with a new mutation (c523_528dup) in GATA3 causing HDR syndrome. Their hearing impairment was congenital, bilateral and symmetric. Audiograms showed mild-to-moderate hearing impairment with a flat audiogram configuration.
24421220 GATA3 may be a useful addition to immunostaining panels for serous effusion specimens when metastatic breast carcinoma is a consideration.
24415069 GATA-3 expression is associated with a less aggressive phenotype and a better prognosis in patients with hormone receptor-positive/HER2-negative breast cancer.
24363163 Inhibition of GATA3 activity or blockade of GATA3 expression may attenuate the interleukin-13 mediated asthma phenotypes.
24346062 inhibits proliferation and induces differentiation of primary keratinocytes
24338248 In the presence of 100 ng/ml IL-11, GATA-3 transcript abundance rose up to ~85-fold of that measured in untreated cells, whereas T-bet transcripts were lowered merely to ~41%
24327562 Mafb is responsible for executing one branch of the SGN differentiation program orchestrated by the Gata3 transcriptional network
24315206 GATA3 is expressed in a minority of oncocytomas. We found an overall lack of GATA3 expression in primary and metastatic renal cell carcinomas.
24235972 intraglomerular predominance of T-bet over GATA3 might be used as diagnosis maker of ABMR in addition to C4d, especially in C4d-negative cases.
24235142 GATA3 abrogated the canonical TGFbeta-Smad signaling by abolishing interactions between Smad4 and its DNA binding elements
24145643 GATA3 is a useful marker in the characterization of not only mammary and urothelial but also renal and germ cell tumors, mesotheliomas, and paragangliomas.
24141364 Genotype at the GATA3 SNP was also associated with early treatment response and risk of acute lymphoblastic leukemia relapse.
24134931 our study suggests that GATA3 and human papillomavirus detection are useful markers for distinguishing urothelial carcinomas from squamous cell carcinomas of the penile urethra.
24124001 TGFBR3 co-downregulated with GATA3 is associated with methylation of the GATA3 gene in bladder urothelial carcinoma.
24121175 findings demonstrate high sensitivity and specificity of the GATA3 diagnostic marker, in regional metastases of urothelial carcinoma
24061521 GATA-3 is rarely positive in bladder adenocarcinomas displaying extracellular mucin production.
23996088 Variation at 10p12.2 (PIP4K2A) and 10p14 (GATA3) influences risk of acute lymphoblastic anemia and tumor subtype. (Meta-analysis)
23958551 The expression of GATA3 and TTF1 distinguishes metastatic mammary carcinoma from primary lung carcinoma.
23939152 Review: owing to its restricted expression in urothelial and breast carcinomas, GATA3 has proved to be a useful immunohistochemical marker for assisting in distinguishing these 2 groups of neoplasms.
23906664 our present study clarifies that the aberrant expression profile of GATA-3 in human clear cell renal carcinoma is possibly involved with tumorigenesis, and the complicated mechanism is worthy of further investigation.
23715162 Report utility of gata3 as an immunohistochemical marker for tumors of the autonomic nervous system.
23604756 GATA3 immunohistochemistry is not helpful in resolving the differential diagnosis between a primary salivary gland neoplasm and metastatic breast cancer
23599157 we evaluated GATA3 expression in urinary bladder paragangliomas, which may closely mimic urothelial carcinomas. GATA3 was positive in 83% of urinary bladder paragangliomas. this will prevent misdiagnosis of urothelial tumor based on GATA3 expression
23577196 GATA3 overexpression results in a reduction of TGFss1 response in MDA-MB-231 (MB-231) cell line
23549873 Data established a seven-gene (AR, ESR2, GATA3, GBX2, KRT16, MMP28 and WNT11) prognostic signature to define a subset of triple-negative breast cancer (TNBC).
23453625 GATA3 lacks sensitivity for distinguishing sarcomatoid renal cell carcinoma from atypical epithelioid epithelioid angiomyolipomas
23446338 Increase in the expression of GATA-3 is associated with endoscopic inflammation in patients with ulcerative colitis.
23435732 Thus, approximately 20 % ER-positive breast cancers have somatic GATA3 mutations that lead to a loss of GATA3 transactivation activity and altered cell invasiveness
23430443 Iranian women who carry the GATA3 gene's 17-CT dinucleotide repeat are at lower risk of developing breast cancer.
23428429 Majority of human prostate tumors show loss of active GATA3 as they progress to the aggressive castrate-resistant stage.
23413906 Data indicate that T-bet mRNA and the ratio of T-bet:GATA-3 mRNA in peripheral blood lymphocytes was lower in the chronic cardiac insufficiency (CCI) intervention group than in the CCI control group.
23395819 Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3
23375642 GATA3 may be a useful marker for metastatic breast carcinoma, especially triple-negative and metaplastic carcinomas its labeling may help distinguish metaplastic carcinoma from malignant phyllodes tumors.
23354167 GATA3/miR-29b axis regulates the breast tumor tumour microenvironment and inhibits metastasis.
23308012 Gene expression of T-bet and GATA-3 by endometrial stromal cells is controlled by hormonal conditions mimicking decidualization, and cyclic AMP.
23291697 Brain calcification caused by HDR syndrome with GATA3 mutation, presenting as a familial brain calcinosis.
23266442 There appears to be no link between GATA-3 positivity and survival in men with breast cancer, whereas in women, GATA-3-positive tumors are typically lower grade with a better prognosis.
23203342 This report adds to the body of data on genotype-phenotype analysis in HDR syndrome.
23172872 GATA3 is pivotal in mediating enhancer accessibility at regulatory regions involved in ESR1-mediated transcription
23063330 report that the transcription factor GATA3 was highly expressed by human type 2 innate lymphoid cells
22985730 GATA3 enhance induction of POU4F3 and myosin VII
22982890 GATA3 IHC is a sensitive marker for uro-thelial carcinoma and positive staining is typically nonfocal and moderate or strong in intensity.
22951729 this study demostrtrates a new T-cell regulatory pathway that directly links decreased proteasome degradation of GATA3, CTLA-4 upregulation, and inhibition of T-cell responses.
22951069 GATA3 tethers TCF7L2 to the genome at a subset of sites in MCF7 cells.
22909160 Dysregulation of Th1 transcription may contribute to heightened expression of STAT6 and GATA3 leading to exaggerated Th2-driven manifestations of allergic disease.
22706858 GATA3 is a sensitive and specific marker for the diagnosis of breast and urothelial carcinomas.
22607700 GATA binding protein 3 is down-regulated in bladder cancer yet strong expression is an independent predictor of poor prognosis in invasive tumor.
22391183 Th1/Th2 imbalance exists in the acute phase of childhood Hench-Schonlein purpura, which correlates with the abnormal expression of transcription factor T-bet and GATA-3.
22336257 Leukocyte T-box expressed in T cells (TBET)/GATA3 mRNA ratio is elevated in patients with acute coronary syndrome, and highest in patients with acute myocardial infarction.
22120723 the BRCA1-GATA3 interaction is important for the repression of genes associated with triple-negative and basal-like breast cancer (BLBCs) including FOXC1
22039304 c-Myb critically regulates IL-13 expression via direct binding to the conserved GATA-3 response element
22019771 Compared with transplant recipients not exhibiting operational tolerance operationally tolerant individuals had a predominant regulatory gene expression profile with higher expression of GATA3, TGFB1, TGFBR1, and FOXP3 which was stable over time.
21930782 A strong association was evident between GATA-3 and caspase-14 expression in preinvasive ductal carcinoma in situ samples, where GATA-3 also displayed prognostic significance
21892208 Expression of GATA3 reprograms BTNBCs to a less aggressive phenotype and inhibits a major mechanism of metastasis through inhibition of LOX.
21878914 All the enhanceosome components comprising estrogen receptor alpha (ERalpha), FOXA1, and GATA3 are necessary for the full repertoire of cancer-associated effects of the ERalpha.
21761347 These results demonstrate a direct positive role of estrogen in regulating Aurora-A expression through activation of the ERalpha-GATA-3 signaling cascade
21743959 CDKN2A, GATA3, CREBBP, ITGA2, NBL1 and TGM4 were down-regulated in the prostate carcinoma glands compared to the corresponding normal glands
21682737 Allergic inflammatory responses are orchestrated by several transcription factors, particularly NF-kappaB and GATA3. (Review)
21638273 CD8 T cells express significantly higher levels of GATA-3 and that this increase is associated with augmented production of IL-13 and is more pronounced in patients with diffuse cutaneous systemic sclerosis.
21611195 The prototypic Th2 cytokine IL-4 was the only cytokine capable of inducing GATA3 in skin explants from healthy donors.
21468546 The ratio of T-bet/GATA-3 can be used as an objective indicator of immune imbalance in patients with allergic asthma.
21399899 Case Report: Report hypomagnesemia in association with HDR syndrome in a patient with GATA3 mutation.
21334719 Plasmacytoid carcinoma of the bladder is a tumor entity, characterized by specific immunohistochemical markers including positivity for GATA-3.
21329183 GATA3 may play a crucial role in oestrogen receptor positive breast cancer patients
21289214 predominance of intraglomerular T-bet expression relative to GATA3 expression associated with poor response to treatment with bolus steroid
21242646 GATA3 abnormalities in patients with HDR syndrome; results consistent with previous finding that GATA3 mutations are usually identified in patients with 2 or 3 of the HDR triad features
21157112 report clinical phenotype and molecular analysis of GATA3 in 5 Japanese HDR patients, including 2 familial cases; sequence analysis of GATA3 demonstrated three novel (R262G, c1063delC and C318) and two reported mutations (c.432insG and c.1051-1G>T)
21120445 The Cys321Ser-mutated GATA3 lacked transactivation activity. Moreover, mutated GATA3 exerted a dominant-negative effect over the transactivation activity of wild-type GATA3.
21114556 The T-bet deficiency and the correlation of GATA-3 expression with the increase of IgE are characteristics of long-lasting asthma.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21037568 Three new susceptibility loci at 2p16.1 (rs1432295, REL, 8q24.21 (rs2019960, PVT1 and 10p14 (rs501764, GATA3).
21037568 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20716621 Observational study of gene-disease association. (HuGE Navigator)
20696860 Translational increase via T cell receptor (TCR) signaling is specific for GATA-3 and responsible for the TCR-dependent increase in GATA-3 associated with enhanced T helper type (Th)2 cell differentiation in T cells from TCR transgenic mice.
20660789 Down-regulation of GATA3 in Hodgkin lymphoma cell lines demonstrated its role in the regulation of IL-5, IL-13, STAT4, and other genes.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20368097 GATA3-NFAT1 complex may play an important role in the regulation of IL-13 transcription in human T cells.
20333526 lower expression in PBMC of psoriatic patients
20237496 Observational study of gene-disease association. (HuGE Navigator)
20237292 Overexpression of GATA-3 restores interleukin (IL)-4 expression in Src family kinase Lck-deficient T helper (Th) type 2 cells; this indicates that decreased interleukin (IL)-4 expression is due in part to reduced amounts of GATA-3.
20189993 GATA3 drives invasive breast cancer cells to undergo the reversal of epithelial-mesenchymal transition.
20154722 GATA3 as a gene involved in transcriptional regulation of Cyclin D1.
20130088 I3C is a novel anticancer agent in human cancers that coexpress ERalpha, GATA3, and AhR, a combination found in a large percentage of breast cancers but not in other critical ERalpha target tissues essential to patient health
19946260 This study evaluates the association of Forkhead-box protein A1 (FOXA1) and GATA-binding protein 3 (GATA3) expressions with Oncotype DX recurrences scores in 77 cases of patients with ER-positive node-negative breast carcinomas
19861286 Compared with the normal controls, T-bet mRNA expression decreased whereas GATA-3 mRNA expression increased significantly in patients with systemic lupus erythematosus.
19805038 GATA-3 occupies genes in both Th1 and Th2 cells and, unexpectedly, shares a large proportion of targets with T-bet.
19798694 This review highlights recent understanding of GATA3 in both normal mammary development and tumor differentiation.
19735555 GATA3 binds to the promoter regions of genes responding to low ionizing radiation doses, and that silencing this protein in irradiated human keratinocytes leads to generalised transcriptional deregulation after X-irradiation.
19728080 HuR binds to the GATA3 3'UTR. Inhibition of HuR decreased GATA3 mRNA, mRNA stability & protein expression.
19723756 A novel missense HDR-associated GATA3 mutation, Thr272Ile, has been identified and shown to result in reduced DNA binding, a partial loss of FOG2 interaction, and a decrease in gene transcription.
19719829 From the described expression pattern, it is highly probable that GATA-3 plays a role in follicular and epidermal morphogenesis.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19674970 GATA3 is indispensable for Ang-1-Tie2-mediated signaling in large vessel endothelial cells
19639723 upregulated expression in nasal polyps tissue in Chinese patients
19625176 Observational study of gene-disease association. (HuGE Navigator)
19615257 T-bet and GATA-3 play a part role in the regulation of Th1/Th2 balance in esophageal cancer.
19559773 GATA3 binds to regulatory elements and controls target gene expression through physical interaction with core promoter regions.
19549328 FOXA1 and GATA-3 have roles in breast cancer, but FOXA1 is expressed in patients with good outcome, while GATA-3 is a luminal marker
19483726 GATA3 inhibits primary breast tumor outgrowth and reduces lung metastatic burden by regulating key genes involved in metastatic breast tumor progression.
19473628 GATA-3 is upregulated in peripheral blood mononuclear cells from patients with minimal change nephrotic syndrome.
19452711 The overexpression of GATA-3 in patients with allergic rhinitis was related to the increase of ICAM-1.
19411068 p18(INK4C) is a downstream target of GATA3, constrains luminal progenitor cell expansion, and suppresses luminal tumorigenesis in the mammary gland
19346497 acquisition of IL-4Ralpha expression after stimulation was inhibited by IFN-lambda1, as was GATA3 expression
19342088 it might be speculated that genetic variations in GATA3 have no major influence on the origin of asthma.
19342088 Observational study of gene-disease association. (HuGE Navigator)
19336263 decreased levels in kidney and PBMC of patients with mesangial proliferative nephritis
19261198 REVIEW: The transcription factor network composed of the estrogen receptor alpha, FOXA1 and GATA3 may control the gene expression pattern in luminal subtype A breast cancers
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19253381 heterozygous nonsense mutation p.R367X of the GATA3 gene in a Chinese family with the HDR syndrome
19248112 GATA-3 expression protects against severe joint inflammation and bone erosion in mice, accompanied by reduced differentiation of Th17 cells, but not Th1 cells, during mBSA-induced arthritis.
19247692 Observational study of gene-disease association. (HuGE Navigator)
19232384 GATA3 was found to bind the site located at -954/-855 and to be a key regulator of abundant KLK1 expression in keratinocyte.
19189213 It is possible that GATA3 mutations occur earlier in the evolution of breast tumors, compared to BRCA1, BRCA2 or sporadic tumors, and are therefore easier to detect by direct sequencing in the presence of some stromal contamination.
19189213 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19094228 Observational study of gene-disease association. (HuGE Navigator)
19092634 expression of S100P, GATA3, and p63 by a majority of ovarian Brenner tumors underscores the similarity between these neoplasms and urothelial proliferations of bladder origin.
19084267 no statistically significant differences in recurrence or survival rates between GATA3-positive and GATA3-negative breast carcinomas
19082709 there is no evidence that either GATA3 rs570613, or any variant in strong linkage disequilibrium with it, is associated with breast cancer risk in women.
19082709 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19059610 reviews the literature from the past 10 y on GATA-3 in normal and pathological states of the mammary gland [review]
19057839 A novel mutation in the GATA3 gene in a patient with PTH-deficient hypoparathyroidism.
19043799 Data demonstrate that zinc influences the proliferation and differentiation, and increases GATA-3 expression, of CD34(+) progenitors both in young and old ages.
18849568 GlcNAc6ST-1 transcription is coordinated with the NF-kappaB/GATA-3 axis, which is known to figure heavily in Th2 cell differentiation
18826115 The SNP at rs1269486 of GATA3 is associated with allergic rhinitis in Chinese.
18826115 Observational study of gene-disease association. (HuGE Navigator)
18772129 cyclic AMP signals enhance histone H3 acetylation at the IL-5 promoter and the concerted binding of GATA-3 and NFATc to the promoter.
18701459 the T cell receptor-mediated induction of Gfi1 controls Th2 cell differentiation through the regulation of GATA3 protein stability
18676680 Observational study of gene-disease association. (HuGE Navigator)
18619618 GATA-3 mRNA expression level was significantly higher preoperatively, and remained higher by postoperative d 7 in patients with postoperative infection after aggressive hepatobiliary pancreatic surgery.
18607915 We aimed to evaluate the association between the SNPs of GATA-3 and AR.
18607915 Observational study of gene-disease association. (HuGE Navigator)
18533032 GATA3 is hypothesized to be integral to the ERalpha pathway
18410415 A SNP in GATA3 is associated with atopic eczema. This finding highlights the importance of GATA3 as an immune-modulating gene in atopic eczema.
18410415 Observational study of gene-disease association. (HuGE Navigator)
18268121 GATA-3 is a breast cancer marker almost exclusively expresses among ER-positive tumors.
18260379 The expression of GATA-3 was negatively correlated to the expression of IL-12 in patients with allergic rhinitis.
18212358 The expression patterns of T-Bet and GATA-3 oppose progesterone receptor, suggesting antagonistic function and/or regulation between PR and T-Bet/GATA-3
18154704 Role in the proliferaative and regenerative capacity of mammary stem and progenitor cells.
18079734 Direct interactions between NKX2-5 and GATA3 as indicated by co-immunoprecipitation data may contribute to MEF2C regulation.
18037162 Gene-gene interaction between GATA3 and IL13 polymorphisms can influence the risk of childhood rhinitis.
18037162 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18006915 Observational study of gene-disease association. (HuGE Navigator)
17845581 Transactivation by GATA-3 increased luciferase expression 100-fold, in the absence of stimulation. Synergistic interactions were demonstrated between Ets1, GATA-3 and AP-1.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17658279 Gata3 is a critical element determining inductive T helper (Th) type 2 cell differentiation and limiting Th1 differentiation by Notch.
17654061 GATA-3 expression in bone marrow stromal cells from chronic aplastic anemia was significantly higher than controls. Expression levels of GATA genes may influence hematopoiesis in BM microenvironment & relate to the pathogenesis/development of AA.
17628972 Activation of GATA-3 might be one of the mechanisms for induction of IL-5 expression in chronic rhinosinusitis.
17616709 GATA-3 is a critical component of the master cell-type-specific transcriptional network including ER alpha and FoxA1 that dictates the phenotype of hormone-dependent breast cancer
17445473 In patients with acute asthma, rosiglitazone could regulate the balance of IFN-gamma and IL-4 by affecting expression of T-bet mRNA and GATA-3.
17445472 In Dermatophagoides farinae-stimulated PBMCs from patients with asthma, expression of GATA-3 and T-bet and FOPX3 expression is decreased.
17390031 WNT8B expression in hepatocyte progenitors derived from human ES cells is due to POU5F1 (OCT3/OCT4) and GATA3, and WNT8B expression in diffuse-type gastric cancer is due to POU5F1 and GATA6
17381824 Gata-3 has a role in specifying and maintaining mammary cell fate
17357106 GATA3 establishes a positive feedback loop that increases transgenic T-cell receptor surface expression in developing CD4 lineage cells.
17277157 GATA-3 nuclear translocation is dependent on its phosphorylation on serine residues by p38 MAPK
17272506 E2A proteins prevent lymphoma cell expansion, at least in part through regulation of Gfi1b and modulation of Gata3 expression.
17234745 The human GATA-3 gene is not regulated in response to polarizing signals that are sufficient to direct Th2-specific expression in mouse cells.
17210674 No mutations were identified in patients with isolated hypoparathyroidism, thereby indicating that GATA3 abnormalities are more likely to result in two or more of the phenotypic features of the HDR syndrome.
17117487 There is an association between expression of Th1/Th2 transcription factors and cytokines (T-bet, GATA-3, IFN-gamma, IL-4,IL-18) in systemic lupus erythematosus.
17114920 A novel heterozygous deletion frameshift mutation of GATA3 in a Japanese kindred with the hypoparathyroidism, deafness and renal dysplasia syndrome.
17111354 Overexpression of GATA3 rescues T-helper type 2 (Th2) cytokine expression in protein kinase C theta-deficient transgenic Th2 cells.
17078870 GATA3 is probably a mediator for the transcriptional upregulation of MUC1 expression in some breast cancers.
17075044 the GATA-3/T-bet transcription factor complex regulates the cell-lineage-specific expression of the lymphocyte homing receptors
17074191 Imbalance of transcription factors T-bet and GATA-3 may be one of the key factors in immune dysregulation of recurrent aphthous ulcerations.
16912130 Three novel mutations in the GATA3 gene responsible for familial hypoparathyroidism and deafness.
16509533 Direct sequencing after PCR amplification of genomic DNA revealed a novel insertional mutation (405insC) in the GATA3 gene of two patients with HDR syndrome (Hypoparathyroidism, sensorineural Deafness and Renal anomaly syndrome).
16498264 Segmental allergen challenge in asthmatics leads to increased GATA-3, c-maf and T-bet expression in BAL cells but not in bronchial biopsies
16357129 Low expression of GATA3 is associated with invasive breast carcinomas
16317090 DL1-induced activation of the Notch1 pathway controls the lineage commitment of early thymic precursors by altering the levels between Spi-B and GATA-3.
16087702 strong specific upregulation of Gata-3 impaired nuclear translocation and its cooperative action with the TGF-beta pathway, suggesting that Gata-3 plays a central role in human pancreatic cancer
15947486 GATA3 is crucially involved in IL-5 gene transcription in human peripheral CD4-positive t cells.
15826950 interleukin-5 transcription repression by the glucocorticoid receptor targets GATA3 signaling and involves histone deacetylase recruitment
15699146 GATA-3 binds and transactivates the NKG2A promoter; coexpression of human GATA-3 with an NKG2A promoter construct in K562 cells leads to enhanced promoter activity.
15637551 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15632006 Expressed in Hodgkin disesase Reed Sternberg cells.
15563083 GATA-3 contributed to the production of IL-4, IL-5 in patients with allergic rhinitis.
15361840 GATA3 is involved in growth control and the maintenance of the differentiated state in epithelial cells and may contribute to tumorigenesis in breast cancer.
15328158 Erythropoietin (Epo) gene expression is under the control of hypoxia-inducible factor 1 (HIF-1), and is negatively regulated by GATA3.
15251440 GATA-3 suppresses IFN-gamma promoter activity independently of binding to cis-regulatory elements
15087456 GATA3 plays important roles in the maintenance of the Th2 phenotype and continuous chromatin remodeling of the specific Th2 cytokine gene locus through cell division.
14985365 GATA3 mutations may have a role in the hypoparathyroidism, deafness, and renal dysplasia (HDR) syndrome
14757746 GATA-3 is an important transcription factor in regulating human Th2 cell differentiation in vivo.
12960249 VZV virus and mite antigens induce expression of this transcription factor in cord blood mononuclear cells, differenetially affecting Th1 and Th2 cells
12767938 Amino acids 19-26 of HIV-1 Nef mediate the binding of Nef to murine GATA-1 and GATA-3 in vitro, suggesting Nef may act as a nuclear regulatory factor through binding to human GATA-1 and GATA-3
12087127 GATA-3 transcriptional imprinting in Th2 lymphocytes: a mathematical model. GATA-3 autoactivation creates a bistable system that can memorize a transient inductive signal.
12057898 A marked reduction in both GATA-3 mRNA and protein expression in HPV-immortalized cell lines was confirmed in cervical carcinoma cell lines.
11970965 Identification of an alternative GATA-3 promoter directing tissue-specific gene expression
11937547 Strong GATA-3 binding to an oligonucleotide containing two GATA-3 motifs has been mapped at a DNase hypersensitivity site in cluster IV of the CD8 gene complex.

AA Sequence

MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA      1 - 70
TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS     71 - 140
LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG    141 - 210
ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTG    211 - 280
HYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNI    281 - 350
NRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT    351 - 420
PMHPPSSLSFGPHHPSSMVTAMG                                                   421 - 443
//

Text Mined References (274)

PMID Year Title
27082299 2016 Association of T-Bet, GATA-3, RORC, and FOXP3 Copy Number Variations With Acute Anterior Uveitis With or Without Ankylosing Spondylitis in Chinese Han.
27053161 2016 Akt1-mediated Gata3 phosphorylation controls the repression of IFN? in memory-type Th2 cells.
27048872 2016 GATA3 induces human T-cell commitment by restraining Notch activity and repressing NK-cell fate.
26922637 2016 GATA3-dependent cellular reprogramming requires activation-domain dependent recruitment of a chromatin remodeler.
26772397 2016 The role of GATA3 in breast carcinomas: a review.
26719157 2016 Negative association between GATA3 and fascin could predict relapse-free and overall survival in patients with breast cancer.
26637396 2015 GATA3 in Breast Cancer: Tumor Suppressor or Oncogene?
26595821 2015 GATA3 Expression in Normal Skin and in Benign and Malignant Epidermal and Cutaneous Adnexal Neoplasms.
26527523 2016 GATA-3 and FOXA1 expression is useful to differentiate breast carcinoma from other carcinomas.
26514990 2015 A novel loss-of-function mutation of GATA3 (p.R299Q) in a Japanese family with Hypoparathyroidism, Deafness, and Renal Dysplasia (HDR) syndrome.
26486740 2015 GATA3 expression in advanced breast cancer: prognostic value and organ-specific relapse.
26313026 2015 The Significance and Therapeutic Potential of GATA3 Expression and Mutation in Breast Cancer: A Systematic Review.
26276775 2015 Evaluating the utility of trefoil factor 1 as a mammary-specific immunostain compared and in conjunction with GATA-3 and mammaglobin in the distinction between carcinoma of breast and lung.
26274030 2015 GATA3 immunohistochemistry expression in histologic subtypes of primary breast carcinoma and metastatic breast carcinoma cytology.
26135559 2015 GATA3 Is a Sensitive and Specific Marker of Benign and Malignant Mesonephric Lesions in the Lower Female Genital Tract.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25917456 2015 Gata3 cooperates with Gcm2 and MafB to activate parathyroid hormone gene expression by interacting with SP1.
25901741 2015 GATA-3 augmentation down-regulates Connexin43 in Helicobacter pylori associated gastric carcinogenesis.
25873156 2015 Copy number variants and genetic polymorphisms in TBX21, GATA3, Rorc, Foxp3 and susceptibility to Behcet's disease and Vogt-Koyanagi-Harada syndrome.
25855136 2015 New basal cell carcinoma susceptibility loci.
25851711 2015 Differential Expression Patterns of GATA3 in Uterine Mesonephric and Nonmesonephric Lesions.
25771973 2015 Identification of a novel GATA3 mutation in a deaf Taiwanese family by massively parallel sequencing.
25753145 2015 GATA3 expression in gestational trophoblastic tissues and tumours.
25651379 2015 S100A7 acts as a dual regulator in promoting proliferation and suppressing squamous differentiation through GATA-3/caspase-14 pathway in A431 cells.
25611245 Uroplakin II (UPII), GATA3, and p40 are Highly Sensitive Markers for the Differential Diagnosis of Invasive Urothelial Carcinoma.
25575062 2015 [Th2 differentiation features of Mycobacterium tuberculosis heat resistant antigen-activated human ??T cells and the regulation of transcription factor T-bet/GATA-3 on differentiation].
25552913 2015 The expression levels of transcription factors T-bet, GATA-3, ROR?t and FOXP3 in peripheral blood lymphocyte (PBL) of patients with liver cancer and their significance.
25425335 2015 GATA-binding protein 3, gross cystic disease fluid protein-15 and mammaglobin have distinct prognostic implications in different invasive breast carcinoma subgroups.
25416956 2014 A proteome-scale map of the human interactome network.
25410484 2014 Shift in GATA3 functions, and GATA3 mutations, control progression and clinical presentation in breast cancer.
25351211 2015 Essential role of GATA3 in regulation of differentiation and cell proliferation in SK-N-SH neuroblastoma cells.
25292313 2015 The effects of galectin-1 on the gene expression of the transcription factors TBX21, GATA-3, FOXP3 and RORC.
25258321 2014 Absent, small or homeotic 2-like protein (ASH2L) enhances the transcription of the estrogen receptor ? gene through GATA-binding protein 3 (GATA3).
25188865 2015 GATA-3 expression in trophoblastic tissues: an immunohistochemical study of 445 cases, including diagnostic utility.
25150746 2014 Diagnostic utility and sensitivities of GATA3 antibodies in triple-negative breast cancer.
25124981 2014 GATA3 mutation in a family with hypoparathyroidism, deafness and renal dysplasia syndrome.
24926087 2014 Semiquantitative GATA-3 immunoreactivity in breast, bladder, gynecologic tract, and other cytokeratin 7-positive carcinomas.
24925221 2014 GATA3 expression in small cell carcinoma of bladder and prostate and its potential role in determining primary tumor origin.
24920014 2014 A meta-analysis of Hodgkin lymphoma reveals 19p13.3 TCF3 as a novel susceptibility locus.
24894987 2014 Regulation of serine protease inhibitor Kazal type-5 (SPINK5) gene expression in the keratinocytes.
24824028 2014 GATA3 expression in sarcomatoid urothelial carcinoma of the bladder.
24820417 2014 Fbw7 targets GATA3 through cyclin-dependent kinase 2-dependent proteolysis and contributes to regulation of T-cell development.
24813204 2014 IFN-? suppresses GATA3 transcription from a distal exon and promotes H3K27 trimethylation of the CNS-1 enhancer in human Th2 cells.
24766459 2014 Insufficient interleukin-12 signalling favours differentiation of human CD4(+) and CD8(+) T cells into GATA-3(+) and GATA-3(+) T-bet(+) subsets in humanized mice.
24758297 2014 Breast tumor specific mutation in GATA3 affects physiological mechanisms regulating transcription factor turnover.
24745616 2014 Differential expression of GATA-3 in urothelial carcinoma variants.
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24713735 2014 Immunohistochemical evaluation of GATA-3 expression in ER-negative breast carcinomas.
24711443 2014 Usefulness of GATA3 and p40 immunostains in the diagnosis of metastatic urothelial carcinoma in cytology specimens.
24660543 2014 Research on the roles of transcription factors T-bet and GATA-3 in aplastic anemia.
24622013 2014 Auditory and vestibular phenotypes associated with GATA3 mutation.
24614117 2014 Association of autoimmune Addison's disease with alleles of STAT4 and GATA3 in European cohorts.
24549642 2014 Differential expression of progesterone receptor, FOXA1, GATA3, and p53 between pre- and postmenopausal women with estrogen receptor-positive breast cancer.
24512009 2014 GATA3 shows differential immunohistochemical expression across thyroid and parathyroid lesions.
24504018 2014 Decreased expression of the GATA3 gene is associated with poor prognosis in primary gastric adenocarcinoma.
24477928 2014 GATA3 mutations define a unique subtype of luminal-like breast cancer with improved survival.
24448324 2014 Loss of GATA3 in bladder cancer promotes cell migration and invasion.
24434941 2014 Audiometric characteristics of a dutch family with a new mutation in GATA3 causing HDR syndrome.
24421220 2014 GATA3: a promising marker for metastatic breast carcinoma in serous effusion specimens.
24415069 2015 Impact of GATA-3 and FOXA1 expression in patients with hormone receptor-positive/HER2-negative breast cancer.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24363163 2014 Linking GATA-3 and interleukin-13: implications in asthma.
24346062 2014 GATA3 inhibits proliferation and induces expression of both early and late differentiation markers in keratinocytes of the human epidermis.
24338248 2014 Downregulation of T-bet/GATA-3 ratio induced by IL-11 treatment is responsible for Th1/Th2 balance restoration in human immune thrombocytopenic purpura (ITP).
24327562 2013 A Gata3-Mafb transcriptional network directs post-synaptic differentiation in synapses specialized for hearing.
24315206 2014 Comprehensive profile of GATA binding protein 3 immunohistochemical expression in primary and metastatic renal neoplasms.
24235972 2013 The diagnostic value of transcription factors T-bet/GATA3 ratio in predicting antibody-mediated rejection.
24235142 2013 GATA3 transcription factor abrogates Smad4 transcription factor-mediated fascin overexpression, invadopodium formation, and breast cancer cell invasion.
24149102 2013 Variation at 3p24.1 and 6q23.3 influences the risk of Hodgkin's lymphoma.
24145643 2014 GATA3: a multispecific but potentially useful marker in surgical pathology: a systematic analysis of 2500 epithelial and nonepithelial tumors.
24141364 2013 Inherited GATA3 variants are associated with Ph-like childhood acute lymphoblastic leukemia and risk of relapse.
24134931 2013 Immunohistochemical profile of the penile urethra and differential expression of GATA3 in urothelial versus squamous cell carcinomas of the penile urethra.
24124001 2013 TGFBR3 co-downregulated with GATA3 is associated with methylation of the GATA3 gene in bladder urothelial carcinoma.
24121175 2013 Is GATA3 expression maintained in regional metastases?: a study of paired primary and metastatic urothelial carcinomas.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
24061521 2013 GATA-3 immunohistochemistry in the differential diagnosis of adenocarcinoma of the urinary bladder.
23996088 2013 Variation at 10p12.2 and 10p14 influences risk of childhood B-cell acute lymphoblastic leukemia and phenotype.
23958551 2014 In search of the ideal immunopanel to distinguish metastatic mammary carcinoma from primary lung carcinoma: a tissue microarray study of 207 cases.
23939152 2013 Value of GATA3 immunostaining in tumor diagnosis: a review.
23906664 2013 GATA-3 is down-regulated in patients with clear cell renal carcinoma.
23824597 2013 Genome-Wide Gene Expression Profiling Revealed a Critical Role for GATA3 in the Maintenance of the Th2 Cell Identity.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23715162 2013 A study of gata3 and phox2b expression in tumors of the autonomic nervous system.
23604756 2013 GATA3 immunohistochemical expression in salivary gland neoplasms.
23599157 2013 GATA3 expression in paragangliomas: a pitfall potentially leading to misdiagnosis of urothelial carcinoma.
23577196 2013 Expression of GATA3 in MDA-MB-231 triple-negative breast cancer cells induces a growth inhibitory response to TGFß.
23549873 2013 Identification of prognosis-relevant subgroups in patients with chemoresistant triple-negative breast cancer.
23453625 2013 Use of PAX8 and GATA3 in diagnosing sarcomatoid renal cell carcinoma and sarcomatoid urothelial carcinoma.
23446338 Predictors of endoscopic inflammation in patients with ulcerative colitis in clinical remission.
23435732 2013 GATA3 mutations found in breast cancers may be associated with aberrant nuclear localization, reduced transactivation and cell invasiveness.
23430443 2013 Polymorphic CT dinucleotide repeat in the GATA3 gene and risk of breast cancer in Iranian women.
23428429 2013 Gata3 antagonizes cancer progression in Pten-deficient prostates.
23413906 2013 Effect of immune modulation therapy on cardiac function and T-bet/GATA-3 gene expression in aging male patients with chronic cardiac insufficiency.
23395819 2013 Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3.
23375642 2013 GATA3 expression in breast carcinoma: utility in triple-negative, sarcomatoid, and metastatic carcinomas.
23354167 2013 GATA3 suppresses metastasis and modulates the tumour microenvironment by regulating microRNA-29b expression.
23308012 2013 Modulation of the expression of the transcription factors T-bet and GATA-3 in immortalized human endometrial stromal cells (HESCs) by sex steroid hormones and cAMP.
23291697 2013 Intracranial calcification in a patient with HDR syndrome and a GATA3 mutation.
23266442 2013 GATA-3 expression in male and female breast cancers: comparison of clinicopathologic parameters and prognostic relevance.
23203342 2012 HDR syndrome: a follow-up genotype-phenotype analysis of a de novo missense Thr272Ile mutation in exon 4 of GATA3.
23172872 2013 GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.
23142663 2012 DNA binding by GATA transcription factor suggests mechanisms of DNA looping and long-range gene regulation.
23063330 2012 The transcription factor GATA3 is essential for the function of human type 2 innate lymphoid cells.
22985730 2012 TFE2 and GATA3 enhance induction of POU4F3 and myosin VIIa positive cells in nonsensory cochlear epithelium by ATOH1.
22982890 2012 Utility of GATA3 immunohistochemistry in differentiating urothelial carcinoma from prostate adenocarcinoma and squamous cell carcinomas of the uterine cervix, anus, and lung.
22951729 2013 Impaired proteasome function activates GATA3 in T cells and upregulates CTLA-4: relevance for Sézary syndrome.
22951069 2012 Cell type-specific binding patterns reveal that TCF7L2 can be tethered to the genome by association with GATA3.
22909160 2012 Reduced T-bet in addition to enhanced STAT6 and GATA3 expressing T cells contribute to human allergen-induced late responses.
22706858 2012 Immunohistochemical evaluation of GATA3 expression in tumors and normal tissues: a useful immunomarker for breast and urothelial carcinomas.
22607700 2012 GATA binding protein 3 is down-regulated in bladder cancer yet strong expression is an independent predictor of poor prognosis in invasive tumor.
22529382 2012 Altered subcellular localization of transcription factor TEAD4 regulates first mammalian cell lineage commitment.
22391183 2012 [Effects of transcription factor T-bet, GATA-3, FoxP3 and CD4(+)CD25(+)regulatory T cells in pathogenesis of child Hench-Schonlein purpura].
22336257 2012 Circulating leukocyte TBET and GATA3 mRNA in patients with acute coronary syndrome.
22120723 2012 BRCA1 and GATA3 corepress FOXC1 to inhibit the pathogenesis of basal-like breast cancers.
22039304 2011 c-Myb and GATA-3 cooperatively regulate IL-13 expression via conserved GATA-3 response element and recruit mixed lineage leukemia (MLL) for histone modification of the IL-13 locus.
22019771 2012 GATA3 and a dominant regulatory gene expression profile discriminate operational tolerance in human transplantation.
21930782 2011 Gata-3 negatively regulates the tumor-initiating capacity of mammary luminal progenitor cells and targets the putative tumor suppressor caspase-14.
21892208 2012 GATA3 inhibits lysyl oxidase-mediated metastases of human basal triple-negative breast cancer cells.
21878914 2011 Cellular reprogramming by the conjoint action of ER?, FOXA1, and GATA3 to a ligand-inducible growth state.
21761347 2010 Estrogen-induced aurora kinase-A (AURKA) gene expression is activated by GATA-3 in estrogen receptor-positive breast cancer cells.
21743959 2011 Analysis of laser-microdissected prostate cancer tissues reveals potential tumor markers.
21682737 2011 Pathophysiology of allergic inflammation.
21638273 2011 GATA-3 up-regulation in CD8+ T cells as a biomarker of immune dysfunction in systemic sclerosis, resulting in excessive interleukin-13 production.
21611195 2011 GATA3 expression is decreased in psoriasis and during epidermal regeneration; induction by narrow-band UVB and IL-4.
21468546 Correlation between the ratio of T-bet/GATA-3 and the levels of IL-4 and IFN-? in patients with allergic asthma.
21399899 2011 Novel DNA mutation in the GATA3 gene in an Emirati boy with HDR syndrome and hypomagnesemia.
21334719 2011 Plasmacytoid urothelial carcinoma of the urinary bladder: clinicopathologic, immunohistochemical, ultrastructural, and molecular analysis of a case series.
21329183 2010 Expression and mutational analysis of GATA3 in Malaysian breast carcinomas.
21289214 2011 Predominance of intraglomerular T-bet or GATA3 may determine mechanism of transplant rejection.
21242646 2011 GATA3 abnormalities in six patients with HDR syndrome.
21157112 2011 Molecular analysis of the GATA3 gene in five Japanese patients with HDR syndrome.
21120445 2011 Novel dominant-negative mutant of GATA3 in HDR syndrome.
21114556 2011 FoxP3, GATA-3 and T-bet expression in elderly asthma.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21037568 2010 A genome-wide association study of Hodgkin's lymphoma identifies new susceptibility loci at 2p16.1 (REL), 8q24.21 and 10p14 (GATA3).
20855495 2010 NKX3.1 is a direct TAL1 target gene that mediates proliferation of TAL1-expressing human T cell acute lymphoblastic leukemia.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20705609 2010 GATA proteins work together with friend of GATA (FOG) and C-terminal binding protein (CTBP) co-regulators to control adipogenesis.
20696860 2010 TCR-dependent translational control of GATA-3 enhances Th2 differentiation.
20660789 2010 Mechanisms of aberrant GATA3 expression in classical Hodgkin lymphoma and its consequences for the cytokine profile of Hodgkin and Reed/Sternberg cells.
20583921 2010 T-bet, GATA-3, and Foxp3 expression and Th1/Th2 cytokine production in the clinical outcome of human infection with Leishmania (Viannia) species.
20554961 2010 Cutting edge: Type I IFN reverses human Th2 commitment and stability by suppressing GATA3.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20484083 2010 c-Myb, Menin, GATA-3, and MLL form a dynamic transcription complex that plays a pivotal role in human T helper type 2 cell development.
20368097 2010 GATA3 siRNA inhibits the binding of NFAT1 to interleukin-13 promoter in human T cells.
20333526 2010 Expression of Th1 and Th2 cytokine-associated transcription factors, T-bet and GATA-3, in peripheral blood mononuclear cells and skin lesions of patients with psoriasis vulgaris.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20237292 2010 Lck mediates Th2 differentiation through effects on T-bet and GATA-3.
20189993 2010 GATA3 inhibits breast cancer metastasis through the reversal of epithelial-mesenchymal transition.
20154722 2010 Cyclin D1 is a direct transcriptional target of GATA3 in neuroblastoma tumor cells.
20130088 2010 Indole-3-carbinol triggers aryl hydrocarbon receptor-dependent estrogen receptor (ER)alpha protein degradation in breast cancer cells disrupting an ERalpha-GATA3 transcriptional cross-regulatory loop.
19946260 2010 Expression of Forkhead-box protein A1, a marker of luminal A type breast cancer, parallels low Oncotype DX 21-gene recurrence scores.
19861286 2009 [Expression of transcription factors T-bet and GATA-3 in peripheral blood mononuclear cells from patients with systemic lupus erythematosus].
19805038 2009 The transcription factors T-bet and GATA-3 control alternative pathways of T-cell differentiation through a shared set of target genes.
19798694 2010 GATA3 in development and cancer differentiation: cells GATA have it!
19735555 2009 GATA3 is a master regulator of the transcriptional response to low-dose ionizing radiation in human keratinocytes.
19728080 2010 The RNA-binding protein HuR regulates GATA3 mRNA stability in human breast cancer cell lines.
19723756 2009 A missense GATA3 mutation, Thr272Ile, causes the hypoparathyroidism, deafness, and renal dysplasia syndrome.
19719829 2010 Expression pattern of GATA-3 in embryonic and fetal human skin suggests a role in epidermal and follicular morphogenesis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19674970 2009 Critical role for GATA3 in mediating Tie2 expression and function in large vessel endothelial cells.
19639723 2009 Characterizing T-cell phenotypes in nasal polyposis in Chinese patients.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19615257 2009 [Expression of transcription factor T-bet and GATA-3 in peripheral blood mononuclear cells and its correlation with immune status in esophageal cancer patients].
19559773 2009 Identification of GATA3 binding sites in Jurkat cells.
19549328 2009 Expression of FOXA1 and GATA-3 in breast cancer: the prognostic significance in hormone receptor-negative tumours.
19483726 2009 GATA3 inhibits breast cancer growth and pulmonary breast cancer metastasis.
19473628 2009 GATA-3 is upregulated in peripheral blood mononuclear cells from patients with minimal change nephrotic syndrome.
19452711 2009 [Experimental research on the relationship between GATA-3 and ICAM-1 in patients with allergic rhinitis].
19411068 2009 CDK inhibitor p18(INK4c) is a downstream target of GATA3 and restrains mammary luminal progenitor cell proliferation and tumorigenesis.
19346497 2009 IFN-lambda1 (IL-29) inhibits GATA3 expression and suppresses Th2 responses in human naive and memory T cells.
19342088 2009 Genetic variants in the GATA3 gene are not associated with asthma and atopic diseases in German children.
19336263 2009 Immunoregulatory effects of sinomenine on the T-bet/GATA-3 ratio and Th1/Th2 cytokine balance in the treatment of mesangial proliferative nephritis.
19261198 2009 FOXA1 in breast cancer.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19253381 2009 Germinal mosaicism of GATA3 in a family with HDR syndrome.
19248180 2009 HDR syndrome: a novel "de novo" mutation in GATA3 gene.
19248112 2009 GATA-3 protects against severe joint inflammation and bone erosion and reduces differentiation of Th17 cells during experimental arthritis.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19232384 2009 Abundant expression of Kallikrein 1 gene in human keratinocytes was mediated by GATA3.
19189213 2010 Frequent somatic mutations of GATA3 in non-BRCA1/BRCA2 familial breast tumors, but not in BRCA1-, BRCA2- or sporadic breast tumors.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19094228 2008 The influence of genetic variation in 30 selected genes on the clinical characteristics of early onset breast cancer.
19092634 2009 Expression of the urothelial differentiation markers GATA3 and placental S100 (S100P) in female genital tract transitional cell proliferations.
19084267 2009 The significance of GATA3 expression in breast cancer: a 10-year follow-up study.
19082709 2009 No evidence that GATA3 rs570613 SNP modifies breast cancer risk.
19059610 2009 GATA-3 as a marker of hormone response in breast cancer.
19057839 2009 A novel mutation in the GATA3 gene of a Japanese patient with PTH-deficient hypoparathyroidism.
19043799 2009 Zinc improves the development of human CD34+ cell progenitors towards NK cells and increases the expression of GATA-3 transcription factor in young and old ages.
18849568 2008 Significance of NF-kappaB/GATA axis in tumor necrosis factor-alpha-induced expression of 6-sulfated cell recognition glycans in human T-lymphocytes.
18826115 2008 [Association of single nucleotide polymorphisms of GATA3 with allergic rhinitis phenotypes in Chinese].
18772129 2008 Cyclic AMP-induced chromatin changes support the NFATc-mediated recruitment of GATA-3 to the interleukin 5 promoter.
18701459 2008 Gfi1-mediated stabilization of GATA3 protein is required for Th2 cell differentiation.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18619618 2009 Preoperative GATA3 mRNA expression in peripheral blood mononuclear cells is up-regulated in patients with postoperative infection following hepatobiliary pancreatic surgery.
18607915 2009 Association of single nucleotide polymorphisms in GATA-3 with allergic rhinitis.
18533032 2008 Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.
18445004 2008 Lymphoid enhancer factor interacts with GATA-3 and controls its function in T helper type 2 cells.
18410415 2008 Polymorphisms in the interleukin 13 and GATA binding protein 3 genes and the development of eczema during childhood.
18268121 2008 GATA-3 expression in breast cancer has a strong association with estrogen receptor but lacks independent prognostic value.
18260379 2007 [Relationship between GATA-3 and IL-12 in patients with allergic rhinitis].
18212358 2008 Cyclic regulation of T-Bet and GATA-3 in human endometrium.
18154704 2007 [Mammary stem and progenitor cells: critical role of the transcription factor Gata-3].
18079734 2008 MEF2C is activated by multiple mechanisms in a subset of T-acute lymphoblastic leukemia cell lines.
18037162 2008 Patterns of GATA3 and IL13 gene polymorphisms associated with childhood rhinitis and atopy in a birth cohort.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006915 2007 Common genetic variation in GATA-binding protein 3 and differential susceptibility to breast cancer by estrogen receptor alpha tumor status.
17845581 2007 Eosinophilic inflammation: mechanisms regulating IL-5 transcription in human T lymphocytes.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17658279 2007 Direct regulation of Gata3 expression determines the T helper differentiation potential of Notch.
17654061 2007 GATA-1, -2 and -3 genes expression in bone marrow microenviroment with chronic aplastic anemia.
17628972 2007 [Relationship between transcription factor GATA-3 and cytokines expression in chronic sinusitis].
17616709 2007 Positive cross-regulatory loop ties GATA-3 to estrogen receptor alpha expression in breast cancer.
17445473 2007 [Effect of rosiglitazone on the expression of T-bet/GATA-3 in T lymphocytes in patients with acute asthma].
17445472 2007 [Expression of T-bet, GATA-3 and FOXP3 mRNA in asthmatic peripheral blood mononuclear cells stimulated by Dermatophagoides farinae antigen].
17390031 2007 Conserved POU/OCT- and GATA-binding sites in 5'-flanking promoter region of mammalian WNT8B orthologs.
17381824 2007 Gata-3 and mammary cell fate.
17357106 2007 GATA3 controls the expression of CD5 and the T cell receptor during CD4 T cell lineage development.
17277157 2007 Regulation of Th2 cytokine genes by p38 MAPK-mediated phosphorylation of GATA-3.
17272506 2007 Growth factor independent 1B (Gfi1b) is an E2A target gene that modulates Gata3 in T-cell lymphomas.
17234745 2007 GATA3 up-regulation associated with surface expression of CD294/CRTH2: a unique feature of human Th cells.
17224074 2007 Somatic sequence alterations in twenty-one genes selected by expression profile analysis of breast carcinomas.
17210674 2007 Functional characterization of GATA3 mutations causing the hypoparathyroidism-deafness-renal (HDR) dysplasia syndrome: insight into mechanisms of DNA binding by the GATA3 transcription factor.
17117487 2007 Elevated gene expression of Th1/Th2 associated transcription factors is correlated with disease activity in patients with systemic lupus erythematosus.
17114920 2006 A novel heterozygous deletion frameshift mutation of GATA3 in a Japanese kindred with the hypoparathyroidism, deafness and renal dysplasia syndrome.
17111354 2006 Involvement of GATA3 in protein kinase C theta-induced Th2 cytokine expression.
17078870 2006 GATA3 protein as a MUC1 transcriptional regulator in breast cancer cells.
17075044 2006 Interaction of GATA-3/T-bet transcription factors regulates expression of sialyl Lewis X homing receptors on Th1/Th2 lymphocytes.
17074191 2006 [Expression of T cell-specific transcription factors T-bet and GATA-3 in recurrent aphthous ulcerations].
16912130 2006 Identification of three novel mutations in the GATA3 gene responsible for familial hypoparathyroidism and deafness in the Chinese population.
16509533 2006 A novel mutation in the GATA3 gene in a family with HDR syndrome (Hypoparathyroidism, sensorineural Deafness and Renal anomaly syndrome).
16498264 2006 Regulation of GATA-3, c-maf and T-bet mRNA expression in bronchoalveolar lavage cells and bronchial biopsies after segmental allergen challenge.
16381901 2006 The LIFEdb database in 2006.
16357129 2005 Identification of GATA3 as a breast cancer prognostic marker by global gene expression meta-analysis.
16317090 2006 Delta-like1-induced Notch1 signaling regulates the human plasmacytoid dendritic cell versus T-cell lineage decision through control of GATA-3 and Spi-B.
16087702 2006 Aberrant gata-3 expression in human pancreatic cancer.
15947486 2005 Role of GATA-3 in IL-5 gene transcription by CD4+ T cells of asthmatic patients.
15826950 2005 Repression of interleukin-5 transcription by the glucocorticoid receptor targets GATA3 signaling and involves histone deacetylase recruitment.
15699146 2005 GATA-3 is an important transcription factor for regulating human NKG2A gene expression.
15637551 2005 Association analysis of common variants of STAT6, GATA3, and STAT4 to asthma and high serum IgE phenotypes.
15632006 2005 Expression of the T-cell transcription factors, GATA-3 and T-bet, in the neoplastic cells of Hodgkin lymphomas.
15563083 2004 [Relationship between GATA-3 and IL-4 and IL-5 in patients with allergic rhinitis].
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361840 2004 Mutation of GATA3 in human breast tumors.
15328158 2004 Oral administration of K-11706 inhibits GATA binding activity, enhances hypoxia-inducible factor 1 binding activity, and restores indicators in an in vivo mouse model of anemia of chronic disease.
15251440 2004 GATA-3 suppresses IFN-gamma promoter activity independently of binding to cis-regulatory elements.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15087456 2004 Essential role of GATA3 for the maintenance of type 2 helper T (Th2) cytokine production and chromatin remodeling at the Th2 cytokine gene loci.
15016828 2004 Interaction between hex and GATA transcription factors in vascular endothelial cells inhibits flk-1/KDR-mediated vascular endothelial growth factor signaling.
14985365 2004 Characterization of GATA3 mutations in the hypoparathyroidism, deafness, and renal dysplasia (HDR) syndrome.
14757746 2004 GATA-3 in human T cell helper type 2 development.
12960249 2003 Different antigens trigger different Th1/Th2 reactions in neonatal mononuclear cells (MNCs) relating to T-bet/GATA-3 expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12217316 2002 GATA proteins identify a novel ventral interneuron subclass in the developing chick spinal cord.
11970965 2002 Cutting edge: Identification of an alternative GATA-3 promoter directing tissue-specific gene expression in mouse and human.
11937547 2002 Identification of a candidate regulatory region in the human CD8 gene complex by colocalization of DNase I hypersensitive sites and matrix attachment regions which bind SATB1 and GATA-3.
11724781 2002 Defects of the heart, eye, and megakaryocytes in peroxisome proliferator activator receptor-binding protein (PBP) null embryos implicate GATA family of transcription factors.
11389161 2001 GATA3 abnormalities and the phenotypic spectrum of HDR syndrome.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10935639 2000 GATA3 haplo-insufficiency causes human HDR syndrome.
10212281 1999 Regulation of the human interleukin-5 promoter by Ets transcription factors. Ets1 and Ets2, but not Elf-1, cooperate with GATA3 and HTLV-I Tax1.
10037815 1999 Combining SSH and cDNA microarrays for rapid identification of differentially expressed genes.
9819382 1998 TAL1 and LIM-only proteins synergistically induce retinaldehyde dehydrogenase 2 expression in T-cell acute lymphoblastic leukemia by acting as cofactors for GATA3.
9020185 1997 Transcriptional activity of TAL1 in T cell acute lymphoblastic leukemia (T-ALL) requires RBTN1 or -2 and induces TALLA1, a highly specific tumor marker of T-ALL.
8088776 1994 Structure and expression of the human GATA3 gene.
7592673 1995 Activation of the interleukin-5 promoter by cAMP in murine EL-4 cells requires the GATA-3 and CLE0 elements.
2050118 1991 A T-cell specific TCR delta DNA binding protein is a member of the human GATA family.
2017177 1991 Murine and human T-lymphocyte GATA-3 factors mediate transcription through a cis-regulatory element within the human T-cell receptor delta gene enhancer.
1871134 1991 The human enhancer-binding protein Gata3 binds to several T-cell receptor regulatory elements.
1827068 1991 Human GATA-3: a lineage-restricted transcription factor that regulates the expression of the T cell receptor alpha gene.