Property Summary

NCBI Gene PubMed Count 269
Grant Count 455
R01 Count 269
Funding $61,073,796.19
PubMed Score 1432.11
PubTator Score 575.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (48)

Disease Z-score Confidence
Major Depressive Disorder 106 5.628 2.8
Asthma 349 5.355 2.7
Hypoparathyroidism 29 5.27 2.6
Cancer 2,346 4.622 2.3
Bipolar Disorder 266 4.418 2.2
Allergic hypersensitivity disease 123 4.399 2.2
Dysthymic disorder 14 4.28 2.1
Sensorineural hearing loss 107 4.168 2.1
Eosinophilia 65 4.136 2.1
Allergic rhinitis 91 4.008 2.0
Melancholia 12 3.707 1.9
Seasonal affective disorder 25 3.682 1.8
Anxiety disorder 22 3.589 1.8
Personality disorder 25 3.312 1.7
Hypersensitivity reaction type II diseas... 235  3.29 1.6
Dermatitis 107 3.107 1.6
Hypochondriasis 7 3.046 1.5
Adult T-Cell Lymphoma/Leukemia 30
Animal Mammary Neoplasms 136
Barakat syndrome 1
Breast cancer 3,094
Colorectal Cancer 47
Hodgkin Disease 16
Hodgkin's lymphoma 11 2.0
Inflammation 109
LEUKEMIA, ACUTE LYMPHOBLASTIC, SUSCEPTIB... 20 
Mammary Neoplasms, Experimental 150
Precursor B-Cell Lymphoblastic Leukemia-... 11 
Precursor Cell Lymphoblastic Leukemia Ly... 42 
Rheumatoid Arthritis 1,160 5.0
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
cutaneous lupus erythematosus 1,056
ductal carcinoma in situ 1,745
fibroadenoma 557
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung cancer 4,466
malignant mesothelioma 3,162
nephrosclerosis 329
osteosarcoma 7,933
pancreatic cancer 2,300
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031
psoriasis 6,685

Expression

  Differential Expression (19)

Synonym

Accession P23771 Q5VWG7 Q5VWG8 Q96J16
Symbols HDR
HDRS

Gene

PANTHER Protein Class (2)

PDB

4HC7   4HC9   4HCA  

Gene RIF (242)

PMID Text
27082299 A high copy number of T-bet and GATA-3 confers susceptibility to AAU and AS, and a high copy number of FOXP3 confers susceptibility to female patients with AAU either with or without AS.
27053161 this study highlights the molecular basis for posttranslational modifications of Gata3 that control the regulation of IFNgamma expression in memory Th2 cells.
27048872 GATA3-mediated positive and negative feedback mechanisms via restraining Notch1 activity control human T-cell lineage commitment.
26922637 These data provide mechanistic insights into GATA3-mediated chromatin reprogramming during MET, and suggest unexpected complexity to transcription factors pioneering
26772397 GATA3 labeling is highest in estrogen receptor-positive carcinomas, it also labels estrogen receptor-negative carcinomas and thus has particular diagnostic utility in the setting of triple-negative breast carcinomas
26719157 Combined marker analysis of GATA3/fascin showed an inverse association and improved prognostic information for patients with breast cancer.
26637396 discuss mutation of GATA3 in breast cancer and the potential mechanism(s) by which mutation may lead to a growth advantage in cancer
26595821 findings demonstrate that GATA3 is expressed in a wide variety of benign and malignant cutaneous epithelial neoplasms
26527523 Immunohistochemical detectionof GATA-3 and FOXA1 expression is useful to differentiate breast carcinoma from other carcinomas.
26514990 Loss-of-function mutation of GATA3 is associated with Hypoparathyroidism, Deafness, and Renal Dysplasia syndrome.
More...

AA Sequence

MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA      1 - 70
TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS     71 - 140
LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG    141 - 210
ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTG    211 - 280
HYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNI    281 - 350
NRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT    351 - 420
PMHPPSSLSFGPHHPSSMVTAMG                                                   421 - 443
//

Text Mined References (274)

PMID Year Title
27082299 2016 Association of T-Bet, GATA-3, RORC, and FOXP3 Copy Number Variations With Acute Anterior Uveitis With or Without Ankylosing Spondylitis in Chinese Han.
27053161 2016 Akt1-mediated Gata3 phosphorylation controls the repression of IFN? in memory-type Th2 cells.
27048872 2016 GATA3 induces human T-cell commitment by restraining Notch activity and repressing NK-cell fate.
26922637 2016 GATA3-dependent cellular reprogramming requires activation-domain dependent recruitment of a chromatin remodeler.
26772397 2016 The role of GATA3 in breast carcinomas: a review.
26719157 2016 Negative association between GATA3 and fascin could predict relapse-free and overall survival in patients with breast cancer.
26637396 2015 GATA3 in Breast Cancer: Tumor Suppressor or Oncogene?
26595821 2015 GATA3 Expression in Normal Skin and in Benign and Malignant Epidermal and Cutaneous Adnexal Neoplasms.
26527523 2016 GATA-3 and FOXA1 expression is useful to differentiate breast carcinoma from other carcinomas.
26514990 2015 A novel loss-of-function mutation of GATA3 (p.R299Q) in a Japanese family with Hypoparathyroidism, Deafness, and Renal Dysplasia (HDR) syndrome.
More...