Property Summary

NCBI Gene PubMed Count 162
Grant Count 307
R01 Count 178
Funding $33,819,886.77
PubMed Score 429.45
PubTator Score 290.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P23769 D3DNB3 Q53YE0 Q96BH0 Q96BH8 Q9BUJ6
Symbols DCML
IMD21
NFE1B
MONOMAC

Gene

PANTHER Protein Class (2)

Gene RIF (124)

PMID Text
27157394 GATA2 was differentially expressed between Fibromyalgia patients and healthy controls.
26766440 GATA2-to-GATA1 switch is prevalent at dynamic enhancers and drives erythroid enhancer commissioning
26325290 we screened 995 transcription factor genes and revealed that CITED2 acts as a GATA-2 activator in human hematopoietic cells. These results provide novel insights into and further identify the regulatory mechanism of GATA-2
26287967 results demonstrated that GATA2 single nucleotide polymorphism rs2335052 is an independent predictor for prognosis of colorectal cancer patients.
26264606 In children and adults with severe GM-CSF negative PAP a close cooperation between pneumologists and hemato-oncologists is needed to diagnose the underlying diseases, some of which are caused by mutations of transcription factor GATA2.
26214525 data unveil essential roles for GATA2 in the lymphatic vasculature and explain why a select catalogue of human GATA2 mutations results in lymphedema.
26161748 Data show that the Lim domain only 2 (LMO2) regulatory element (element-25) region consists of transcription factor GATA2-binding myeloid ennhancer and RUNX protein-binding T-cell repressor.
25907033 Transgenic human GATA2 appeared to induce growth via downstream activation of Nmyc and Hoxa9 in mice. GATA2 overexpression at low level confers self-renewal capacity to myeloid progenitors and is relevant to myeloid leukemia development.
25810277 Altered binding of GATA2 (and Sp1/TBP) mediates aberrant MAOA expression under pathophysiological conditions.
25707769 High GATA2 promotes glioma progression through EGFR/ERK/Elk-1 pathway.
More...

AA Sequence

MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARV      1 - 70
SYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSV     71 - 140
YPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDG    141 - 210
VKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTP    211 - 280
KQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCA    281 - 350
NCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC    351 - 420
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG              421 - 480
//

Text Mined References (165)

PMID Year Title
27157394 Genome-wide expression profiling in the peripheral blood of patients with fibromyalgia.
26766440 2016 Dynamic Control of Enhancer Repertoires Drives Lineage and Stage-Specific Transcription during Hematopoiesis.
26325290 2015 High-Throughput siRNA Screening to Reveal GATA-2 Upstream Transcriptional Mechanisms in Hematopoietic Cells.
26287967 2015 GATA2 rs2335052 Polymorphism Predicts the Survival of Patients with Colorectal Cancer.
26264606 2015 GATA2 deficiency in children and adults with severe pulmonary alveolar proteinosis and hematologic disorders.
26214525 2015 GATA2 is required for lymphatic vessel valve development and maintenance.
26161748 2015 The LMO2 -25 Region Harbours GATA2-Dependent Myeloid Enhancer and RUNX-Dependent T-Lymphoid Repressor Activity.
25907033 2015 Low-level GATA2 overexpression promotes myeloid progenitor self-renewal and blocks lymphoid differentiation in mice.
25810277 2015 Molecular mechanism of monoamine oxidase A gene regulation under inflammation and ischemia-like conditions: key roles of the transcription factors GATA2, Sp1 and TBP.
25707769 2015 GATA2 promotes glioma progression through EGFR/ERK/Elk-1 pathway.
More...