Property Summary

NCBI Gene PubMed Count 182
PubMed Score 475.51
PubTator Score 290.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Hematologic cancer 12 0.0 1.2
Immune system cancer 140 0.0 1.2
Disease Target Count Z-score Confidence
Cancer 2499 4.334 2.2
Anemia 365 4.193 2.1
Pulmonary alveolar proteinosis 15 4.041 2.0

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 7.5e-04
Breast cancer 1.600 1.7e-04
glioblastoma -1.100 4.4e-03
group 4 medulloblastoma -1.400 6.0e-04
interstitial cystitis -2.300 2.1e-04
intraductal papillary-mucinous adenoma (... -1.700 2.9e-04
intraductal papillary-mucinous carcinoma... -2.100 3.2e-05
intraductal papillary-mucinous neoplasm ... -2.300 1.1e-03
invasive ductal carcinoma 1.200 3.2e-02
lung adenocarcinoma -1.705 1.5e-12
lung carcinoma -1.100 2.9e-08
malignant mesothelioma 1.300 1.8e-06
medulloblastoma, large-cell -1.500 9.7e-06
non-small cell lung cancer -1.974 6.9e-29
osteosarcoma -1.731 8.6e-04
pituitary cancer 1.800 1.1e-03
psoriasis -1.100 1.2e-37

Protein-protein Interaction (5)

Gene RIF (143)

AA Sequence

MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARV      1 - 70
SYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSV     71 - 140
YPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDG    141 - 210
VKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTP    211 - 280
KQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCA    281 - 350
NCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC    351 - 420
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG              421 - 480
//

Text Mined References (186)

PMID Year Title