Property Summary

NCBI Gene PubMed Count 25
Grant Count 1
Funding $12,080.67
PubMed Score 49.52
PubTator Score 28.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.830 0.000
malignant mesothelioma -1.600 0.000
astrocytic glioma -1.600 0.014
ependymoma -2.000 0.000
psoriasis -1.500 0.000
glioblastoma -2.100 0.000
oligodendroglioma -1.200 0.000
osteosarcoma -2.882 0.000
group 4 medulloblastoma -3.800 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -1.600 0.002
lung cancer -2.300 0.002
interstitial cystitis 1.700 0.001
adult high grade glioma -2.200 0.001
pilocytic astrocytoma -1.700 0.000
Alzheimer's disease -1.500 0.023
Pick disease -2.500 0.002
ulcerative colitis 1.200 0.003
ovarian cancer 1.100 0.007

Synonym

Accession P23763 A8MVP3 D3DUR3 O75468 Q15857 Q6FG94 Q8IVC9 VAMP-1
Symbols SYB1
SPAX1
VAMP-1

Gene

 Grant Application (1)

Gene RIF (6)

PMID Text
25881291 Genetically regulated VAMP1 expression in the brain may modify both Alzheimer's disease risk and may contribute to Alzheimer's pathophysiology
25010769 residue 48 of VAMP1 varies frequently between M and I across seventeen closely related primate species, suggesting a potential selective pressure from members of BoNTs for resistance in vertebrates.
22958904 This report identifies vesicle-associated membrane protein 1 (VAMP1), which encodes a critical protein for synaptic exocytosis, as the responsible gene fora dominantly inherited spastic ataxia
21330375 multiple domains outside the R-SNARE of tomosyn are critical to the efficacy of inhibition by tomosyn on exocytotic secretion
20877624 Observational study of gene-disease association. (HuGE Navigator)
18457912 The expression of the SNARE protein SNAP-25 and its cellular homologue SNAP-23, as well as syntaxin1 and VAMP (vesicle-associated membrane protein) in samples of normal parathyroid tissue, chief cell adenoma, and parathyroid carcinoma, was examined.

AA Sequence

MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD      1 - 70
ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT                           71 - 118
//

Text Mined References (27)

PMID Year Title
25881291 2015 Genetically-controlled Vesicle-Associated Membrane Protein 1 expression may contribute to Alzheimer's pathophysiology and susceptibility.
25416956 2014 A proteome-scale map of the human interactome network.
25010769 2014 Widespread sequence variations in VAMP1 across vertebrates suggest a potential selective pressure from botulinum neurotoxins.
24534378 2014 Distribution of SNAP25, VAMP1 and VAMP2 in mature and developing deep cerebellar nuclei after estrogen administration.
24152687 2013 Characterization of SNARE proteins in human pituitary adenomas: targeted secretion inhibitors as a new strategy for the treatment of acromegaly?
22958904 2012 VAMP1 mutation causes dominant hereditary spastic ataxia in Newfoundland families.
22289120 2012 Specificity of botulinum protease for human VAMP family proteins.
21330375 2011 Structural and functional analysis of tomosyn identifies domains important in exocytotic regulation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18457912 2008 Heterogeneous expression of SNARE proteins SNAP-23, SNAP-25, Syntaxin1 and VAMP in human parathyroid tissue.
More...