Property Summary

NCBI Gene PubMed Count 52
Grant Count 153
R01 Count 96
Funding $14,083,384.54
PubMed Score 430.72
PubTator Score 208.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.000

Synonym

Accession P23759 E9PFV9 Q0VA99 Q2PJS5
Symbols HUP1
RMS2
PAX7B

Gene

 GO Component (1)

Gene RIF (31)

PMID Text
26234681 these results suggest that sarcoma metastasis can be partially controlled through Pax7/MyoD-dependent activation of miR-182 and provide insight into the role that myogenic transcription factors have in sarcoma progression
24554430 RAGE upregulates myogenin which upregulates MyoD and downregulates PAX7, with consequent inhibition of proliferation and stimulation of differentiation.
24084740 Pax7 responds to NF-kappaB by impairing the regenerative capacity of myogenic cells in the muscle microenvironment to drive muscle wasting in cancer.
23512105 In addition, eight genes classified as 'second tier' hits in the original study (PAX7, THADA, COL8A1/FILIP1L, DCAF4L2, GADD45G, NTN1, RBFOX3 and FOXE1) showed evidence of linkage and association in this replication sample.
23463464 Our study replicated previous GWAS findings for markers in VAX1 in the Asian population, and identified rare variants in PAX7 and VAX1 that may contribute to the etiology of CL(P)
23247248 SUMOylation of Pax7 is essential for neural crest development in chick embryos and for the inhibitory roles of Pax7 in C2C12-muscle differentiation.
23205730 High prevalence of 1p36 microdeletions in B-cell non-Hodgkin lymphomas is associated with PAX7 loss.
23079386 PAX3/7-FKHR gene fusions expression was detected in 56% of ARMS tumor samples.
22374423 PAX7-FKHR fusion gene inhibits myogenic differentiation via NF-kappaB upregulation.
22197543 Detection of PAX3/PAX7-FKHR fusion transcripts is a novel tool for Rhabdomyosarcoma diagnosis
More...

AA Sequence

MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPC      1 - 70
VISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPRQVATPDVEKKIEEYKRENPGMFSWEIRDRLLKD     71 - 140
GHCDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPD    141 - 210
LPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQ    211 - 280
LAAFNHLLPGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAADTSS    281 - 350
AYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSIS    351 - 420
ASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQTAVDYLAKNVSLSTQRRMKLGEH    421 - 490
SAVLGLLPVETGQAY                                                           491 - 505
//

Text Mined References (55)

PMID Year Title
26234681 2016 Myogenic transcription factors regulate pro-metastatic miR-182.
24554430 2014 RAGE signaling deficiency in rhabdomyosarcoma cells causes upregulation of PAX7 and uncontrolled proliferation.
24084740 2013 NF-?B-mediated Pax7 dysregulation in the muscle microenvironment promotes cancer cachexia.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23512105 2013 Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study.
23463464 2013 Replication of genome wide association identified candidate genes confirm the role of common and rare variants in PAX7 and VAX1 in the etiology of nonsyndromic CL(P).
23247248 2013 SUMOylation of Pax7 is essential for neural crest and muscle development.
23205730 2013 High prevalence of 1p36 microdeletions in B-cell non-Hodgkin lymphomas (NHL) is associated with PAX7 loss.
23079386 2012 Investigation of PAX3/7-FKHR fusion genes and IGF2 gene expression in rhabdomyosarcoma tumors.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
More...