Property Summary

NCBI Gene PubMed Count 42
Grant Count 27
R01 Count 20
Funding $3,991,742.14
PubMed Score 76.64
PubTator Score 62.10

Knowledge Summary

Patent (3,433)

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.900 0.003
malignant mesothelioma -3.400 0.000
esophageal adenocarcinoma -2.300 0.021
psoriasis -1.700 0.003
osteosarcoma -2.586 0.000
medulloblastoma, large-cell -1.100 0.001
primary pancreatic ductal adenocarcinoma 1.227 0.030
non-small cell lung cancer 1.217 0.000
active Crohn's disease -1.235 0.026
pancreatic cancer 1.200 0.028

Gene RIF (21)

PMID Text
26964756 Decreased DNA methylation at this enhancer enables recruitment of the profibrotic transcription factor early growth response 1 (EGR1) and facilitates radiation-induced DGKA transcription in cells from patients later developing fibrosis.
26420856 An abandoned compound that also inhibits serotonin receptors may have more translational potential as a DGKa inhibitor, but more potent and specific DGKa inhibitors are sorely needed
25921290 Redundant and specialized roles for diacylglycerol kinases alpha and zeta in the control of T cell functions.
25248744 DGKalpha generates phosphatidic acid to drive its own recruitment to tubular recycling endosomes via its interaction with MICAL-L1
24887021 These data indicates the existence of a SDF-1alpha induced DGKalpha - atypical PKC - beta1 integrin signaling pathway, which is essential for matrix invasion of carcinoma cells.
24158111 High diacylglycerol kinase alpha expression is associated with glioblastoma.
22573804 DGK-alpha was more highly expressed in CD8-tumor-infiltrating T cellscompared with that in CD8non-tumor kidney-infiltrating lymphocytes.
22425622 DGKalpha is involved in hepatocellular carcinoma progression by activation of the MAPK pathway.
22271650 Antigen-specific CD8-positive T cells from DGKalpha-deficient transgenic mice show enhanced expansion and increased cytokine production after lymphocytic choriomeningitis virus infection, yet DGK-deficient memory CD8+ T cells exhibit impaired expansion.
22048771 SAP-mediated inhibition of DGKalpha sustains diacylglycerol signaling, thereby regulating T cell activation
More...

AA Sequence

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL      1 - 70
SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL     71 - 140
QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP    141 - 210
KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG    211 - 280
RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT    281 - 350
SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL    351 - 420
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE    421 - 490
MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE    491 - 560
FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG    561 - 630
ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE    631 - 700
PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS                                       701 - 735
//

Text Mined References (45)

PMID Year Title
26964756 2016 Epigenetic regulation of diacylglycerol kinase alpha promotes radiation-induced fibrosis.
26420856 2015 Molecular Pathways: Targeting Diacylglycerol Kinase Alpha in Cancer.
25921290 2015 Redundant and specialized roles for diacylglycerol kinases ? and ? in the control of T cell functions.
25248744 2014 Diacylglycerol kinase ? regulates tubular recycling endosome biogenesis and major histocompatibility complex class I recycling.
24887021 2014 The diacylglycerol kinase ?/atypical PKC/?1 integrin pathway in SDF-1? mammary carcinoma invasiveness.
24158111 2013 A miR-297/hypoxia/DGK-? axis regulating glioblastoma survival.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22627129 2012 Biosynthesis of alkyl lysophosphatidic acid by diacylglycerol kinases.
22573804 2012 High DGK-? and disabled MAPK pathways cause dysfunction of human tumor-infiltrating CD8+ T cells that is reversible by pharmacologic intervention.
22425622 2012 Diacylglycerol kinase alpha enhances hepatocellular carcinoma progression by activation of Ras-Raf-MEK-ERK pathway.
More...