Property Summary

NCBI Gene PubMed Count 45
PubMed Score 80.20
PubTator Score 62.10

Knowledge Summary

Patent (3,433)

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.235 2.6e-02
esophageal adenocarcinoma -1.500 2.8e-02
malignant mesothelioma -3.400 1.0e-08
medulloblastoma, large-cell -1.100 9.5e-04
non-small cell lung cancer 1.217 3.3e-10
osteosarcoma -2.586 6.6e-08
pancreatic cancer 1.200 2.8e-02
primary pancreatic ductal adenocarcinoma 1.227 3.0e-02
psoriasis -1.700 3.2e-03
Rheumatoid arthritis -1.900 2.6e-03

Protein-protein Interaction (1)

Gene RIF (24)

AA Sequence

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL      1 - 70
SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL     71 - 140
QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP    141 - 210
KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG    211 - 280
RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT    281 - 350
SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL    351 - 420
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE    421 - 490
MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE    491 - 560
FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG    561 - 630
ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE    631 - 700
PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS                                       701 - 735
//

Text Mined References (48)

PMID Year Title