Property Summary

NCBI Gene PubMed Count 84
Grant Count 18
R01 Count 9
Funding $1,153,664.36
PubMed Score 108.53
PubTator Score 102.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.390 0.003
malignant mesothelioma -4.400 0.000
osteosarcoma 1.415 0.001
astrocytoma 1.600 0.049
glioblastoma 1.100 0.031
medulloblastoma, large-cell -1.800 0.002
autosomal dominant Emery-Dreifuss muscul... 1.140 0.009
tuberculosis 1.200 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.022
X-linked cerebral adrenoleukodystrophy -1.300 0.021
lung cancer -4.100 0.000
colon cancer -3.300 0.000
group 4 medulloblastoma -1.600 0.000
lung carcinoma -1.100 0.000
gastric carcinoma 1.500 0.007
invasive ductal carcinoma -1.200 0.014
ulcerative colitis 1.100 0.002
ovarian cancer 2.400 0.000
dermatomyositis 1.400 0.006

Gene RIF (48)

PMID Text
26729804 our data show that CD147 interacts via its immunomodulatory domains with PMCA4 to bypass TCR proximal signaling and inhibit IL-2 expression.
26676968 RNA sequencing identified a novel ATPase, Ca2+ transporting, plasma membrane 4(ATP2B4)-protein kinase C-alpha (PRKCA) fusion transcript.
26448358 We also nominate a new candidate gene in congenital arrhythmia, ATP2B4, and provide experimental evidence of a regulatory role for variants discovered using this framework.
26116539 While PMCA1b has a housekeeping function in colon cancer cells, PMCA4b participates in the reorganization of the calcium signaling machinery during cell differentiation.
25798335 p.R268Q mutation in PMCA4 resulted in functional changes in calcium homeostasis in human neuronal cells. This suggests that calcium dysregulation may be associated with the pathogenesis of Familial spastic paraplegia
25690014 The slowly activating PMCA4b isoform produced long-lasting Ca2+ oscillations in response to store-operated Ca2+ entry.
25233416 Mechanism of PMCA4 that creates lipid asymmetry is well understood in terms of ATP hydrolysis; molecular models exist for trajectory taken by phospholipid substrates through the enzyme. [review-like article]
25147342 PMCA4 inhibits the activation of the calcineurin/NFAT pathway on VEGF stimulation of endothelial cells, leading to a significant attenuation of VEGF-mediated angiogenesis.
25119969 Calcium dysregulation resulting from a novel missense mutation (c.803G>A, p.R268Q) in the PMCA4 (ATP2B4) gene may be associated with the pathogenesis of familial spastic paraplegia.
24583174 No significant relationship was detected in the level of expression of the ATP2B4 and ATP5B genes in cancerous and healthy tissues of colorectal cancer patients.
More...

AA Sequence

MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNP      1 - 70
ADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPAGEENELCGQVATTPE     71 - 140
DENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQCRIEQEQKFSIIRNGQLIQLPVAEIVVGD    141 - 210
IAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQT    211 - 280
GIILTLLGVNEDDEGEKKKKGKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKS    281 - 350
VLQGKLTRLAVQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVA    351 - 420
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGGIHYRQI    421 - 490
PSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALLGFVTDLKQDYQAVRNEVPEE    491 - 560
KLYKVYTFNSVRKSMSTVIRNPNGGFRMYSKGASEIILRKCNRILDRKGEAVPFKNKDRDDMVRTVIEPM    561 - 630
ACDGLRTICIAYRDFDDTEPSWDNENEILTELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNI    631 - 700
NTARAIATKCGILTPGDDFLCLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIID    701 - 770
STVGEHRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI    771 - 840
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLKRRPYGRNKP    841 - 910
LISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRK    911 - 980
IHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFSCTSLSLSQWLWCLFIGIGELLWGQFISAIP    981 - 1050
TRSLKFLKEAGHGTTKEEITKDAEGLDEIDHAEMELRRGQILWFRGLNRIQTQIDVINTFQTGASFKGVL   1051 - 1120
RRQNMGQHLDVKLVPSSSYIKVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEEELPRTPLLDEEEEE   1121 - 1190
NPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV                      1191 - 1241
//

Text Mined References (92)

PMID Year Title
26729804 2016 Association of CD147 and Calcium Exporter PMCA4 Uncouples IL-2 Expression from Early TCR Signaling.
26676968 2016 Pigment-Synthesizing Melanocytic Neoplasm With Protein Kinase C Alpha (PRKCA) Fusion.
26448358 2015 Sequence to Medical Phenotypes: A Framework for Interpretation of Human Whole Genome DNA Sequence Data.
26116539 2015 Selective upregulation of the expression of plasma membrane calcium ATPase isoforms upon differentiation and 1,25(OH)2D3-vitamin treatment of colon cancer cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25798335 2015 PMCA4 (ATP2B4) mutation in familial spastic paraplegia causes delay in intracellular calcium extrusion.
25690014 2015 Plasma membrane Ca²?-ATPases can shape the pattern of Ca²? transients induced by store-operated Ca²? entry.
25233416 2014 Substrate trajectory through phospholipid-transporting P4-ATPases.
25147342 2014 Plasma membrane calcium ATPase isoform 4 inhibits vascular endothelial growth factor-mediated angiogenesis through interaction with calcineurin.
25119969 2014 PMCA4 (ATP2B4) mutation in familial spastic paraplegia.
More...