Property Summary

NCBI Gene PubMed Count 87
PubMed Score 122.84
PubTator Score 102.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.600 4.9e-02
autosomal dominant Emery-Dreifuss muscul... 1.140 9.2e-03
Chronic Lymphocytic Leukemia 1.390 2.8e-03
colon cancer -2.700 1.5e-04
dermatomyositis 1.400 5.6e-03
gastric carcinoma 1.200 3.4e-02
glioblastoma 1.100 3.1e-02
group 3 medulloblastoma -1.100 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.2e-02
invasive ductal carcinoma -1.200 1.4e-02
lung cancer -2.600 2.2e-03
lung carcinoma -1.100 1.4e-18
malignant mesothelioma -4.400 4.2e-09
medulloblastoma, large-cell -1.100 7.4e-03
osteosarcoma 1.415 1.1e-03
ovarian cancer 2.400 2.9e-05
tuberculosis 1.200 6.7e-05
ulcerative colitis 1.100 1.6e-03
X-linked cerebral adrenoleukodystrophy -1.300 2.1e-02

Protein-protein Interaction (1)

Gene RIF (51)

AA Sequence

MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNP      1 - 70
ADLEKRRQVFGHNVIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPAGEENELCGQVATTPE     71 - 140
DENEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQCRIEQEQKFSIIRNGQLIQLPVAEIVVGD    141 - 210
IAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQT    211 - 280
GIILTLLGVNEDDEGEKKKKGKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKS    281 - 350
VLQGKLTRLAVQIGKAGLLMSALTVFILILYFVIDNFVINRRPWLPECTPIYIQYFVKFFIIGITVLVVA    351 - 420
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGGIHYRQI    421 - 490
PSPDVFLPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALLGFVTDLKQDYQAVRNEVPEE    491 - 560
KLYKVYTFNSVRKSMSTVIRNPNGGFRMYSKGASEIILRKCNRILDRKGEAVPFKNKDRDDMVRTVIEPM    561 - 630
ACDGLRTICIAYRDFDDTEPSWDNENEILTELTCIAVVGIEDPVRPEVPDAIAKCKQAGITVRMVTGDNI    631 - 700
NTARAIATKCGILTPGDDFLCLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIID    701 - 770
STVGEHRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI    771 - 840
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLKRRPYGRNKP    841 - 910
LISRTMMKNILGHAFYQLIVIFILVFAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRK    911 - 980
IHGEKNVFSGIYRNIIFCSVVLGTFICQIFIVEFGGKPFSCTSLSLSQWLWCLFIGIGELLWGQFISAIP    981 - 1050
TRSLKFLKEAGHGTTKEEITKDAEGLDEIDHAEMELRRGQILWFRGLNRIQTQIDVINTFQTGASFKGVL   1051 - 1120
RRQNMGQHLDVKLVPSSSYIKVVKAFHSSLHESIQKPYNQKSIHSFMTHPEFAIEEELPRTPLLDEEEEE   1121 - 1190
NPDKASKFGTRVLLLDGEVTPYANTNNNAVDCNQVQLPQSDSSLQSLETSV                      1191 - 1241
//

Text Mined References (95)

PMID Year Title