Property Summary

NCBI Gene PubMed Count 20
PubMed Score 17.16
PubTator Score 23.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession P23610 Q5HY66 Q8IXP3
Symbols F8A
HAP40
DXS522E

Gene

  Ortholog (1)

Species Source Disease
Rat OMA Inparanoid

Gene RIF (7)

AA Sequence

MAAAAAGLGGGGAGPGPEAGDFLARYRLVSNKLKKRFLRKPNVAEAGEQFGQLGRELRAQECLPYAAWCQ      1 - 70
LAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAAYGEPLQAAASALGAAVRLHLELGQPAA     71 - 140
AAALCLELAAALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRL    141 - 210
AREHGSHPVQSLPPPPPPAPQPGPGATPALPAALLPPNSGSAAPSPAALGAFSDVLVRCEVSRVLLLLLL    211 - 280
QPPPAKLLPEHAQTLEKYSWEAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTA    281 - 350
EQNHLLHLVLQETISPSGQGV                                                     351 - 371
//

Text Mined References (26)

PMID Year Title