Property Summary

NCBI Gene PubMed Count 39
Grant Count 52
R01 Count 43
Funding $4,570,125.32
PubMed Score 94.62
PubTator Score 83.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
oligodendroglioma 1.100 0.042
psoriasis -2.100 0.001
osteosarcoma -1.014 0.001
medulloblastoma, large-cell 1.100 0.000
lung cancer 1.200 0.001
ovarian cancer -2.000 0.000

Synonym

Accession P23588 B4DS13 Q4G0E3 Q53HQ2 Q6GPH5 Q6IB46 Q8WYK5 eIF-4B
Symbols EIF-4B
PRO1843

Gene

PDB

1WI8   2J76  

Gene RIF (19)

PMID Text
25955794 MicroRNA-216a inhibits the growth and metastasis of oral squamous cell carcinoma by targeting eIF4B.
25631074 Cellular biotinylated eukaryotic translation initiation factor 4B (EIF4B) protein is incorporated into HIV-1 Gag virus-like particles
25220053 S6K1 enhances c-Myc translation efficiency by modulating the phosphorylation of eukaryotic initiation factor eIF4B, which is critical to unwind its structured 5' untranslated region.
25129346 EIF4B, as a potentially key fragile point in EGFR and mTOR inhibitor synergy.
24829357 The protein level of eukaryotic translation initiation factor 4B (eIF4B) was dramatically reduced in A549 cells as well as in the lung, spleen, and thymus of mice infected with influenza A virus.
24205356 eIF4B is the RSK downstream effector responsible for elevated Lamgamma2 as well as MYC protein in neoplastic epithelial cells.
24135829 eIF4B-driven expression of these key survival proteins is directly correlated with patient outcome, and eIF4B, DAXX and ERCC5 are identified as novel prognostic markers for poor survival in DLBCL
24063684 Report EIF4B binding within the IRES domain V of the coxsackie virus B3 mutant strain.
23813671 Overexpression of pim-2 may inhibit the apoptosis of prostate cancer cells through phosphorylation of eIF4B, thus promoting tumorigenesis.
23749639 our results identify eIF4B as a critical substrate of Pim kinases in mediating the activity of Abl oncogenes
More...

AA Sequence

MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDR      1 - 70
SILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFG     71 - 140
YAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDD    141 - 210
YPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRA    211 - 280
FGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS    281 - 350
TSQSTRAASIFGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT    351 - 420
GSESSQTGTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSN    421 - 490
PPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQTGNSSRGPGDGGNRDHWKESD    491 - 560
RKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDGEDENEGEDYAE                       561 - 611
//

Text Mined References (53)

PMID Year Title
25955794 2015 MicroRNA-216a inhibits the growth and metastasis of oral squamous cell carcinoma by targeting eukaryotic translation initiation factor 4B.
25220053 2014 The mTORC1/S6K1 pathway regulates glutamine metabolism through the eIF4B-dependent control of c-Myc translation.
25129346 2014 Abrogating phosphorylation of eIF4B is required for EGFR and mTOR inhibitor synergy in triple-negative breast cancer.
24829357 2014 Influenza A virus-induced degradation of eukaryotic translation initiation factor 4B contributes to viral replication by suppressing IFITM3 protein expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24205356 2013 RSK activation of translation factor eIF4B drives abnormal increases of laminin ?2 and MYC protein during neoplastic progression to squamous cell carcinoma.
24135829 2014 A role for eukaryotic initiation factor 4B overexpression in the pathogenesis of diffuse large B-cell lymphoma.
24063684 2013 Impaired binding of standard initiation factors eIF3b, eIF4G and eIF4B to domain V of the live-attenuated coxsackievirus B3 Sabin3-like IRES--alternatives for 5'UTR-related cardiovirulence mechanisms.
23813671 2013 The over-expression of Pim-2 promote the tumorigenesis of prostatic carcinoma through phosphorylating eIF4B.
23749639 2013 eIF4B phosphorylation by pim kinases plays a critical role in cellular transformation by Abl oncogenes.
More...