Property Summary

NCBI Gene PubMed Count 89
Grant Count 86
R01 Count 50
Funding $9,682,214.23
PubMed Score 711.34
PubTator Score 348.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.000
fibroadenoma 1.800 0.002
adult high grade glioma -1.100 0.000
group 4 medulloblastoma -1.300 0.000
pilocytic astrocytoma -1.100 0.000
posterior fossa group A ependymoma 1.300 0.013
psoriasis -1.100 0.000

Synonym

Accession P23582 Q4ZG41
Symbols CNP
CNP2

Gene

PANTHER Protein Class (2)

PDB

1JDP  

 GO Function (1)

Gene RIF (62)

PMID Text
26801306 CNP levels rose after paroxysmal supraventricular tachycardia and continued to rise after the termination.
26485840 An increased level of NT-pro CNP is a promising non-invasive marker of hepatitis C related CLD complications and disease progression.
26459742 CNP and FGF-23 act through a close or reciprocal pathway and are in agreement with recent studies demonstrating a down-regulatory role of the mitogen-activated protein kinase activity by CNP
26307537 examined whether CNP reduces hyaluronan production and export via members of the multidrug resistance protein (MRP) and diminishes pro-inflammatory effects in chondrocytes
25926602 CNP/NPR-B can affect sperm motility and acrosome reaction, thus regulating the reproductive function of males
25811760 Plasma CNP might serve as a useful predictor for the therapeutic efficacy of metoprolol on postural tachycardia syndrome in children.
25808436 CNP/proCNP could be new markers in human prostate cancer
25728306 This case supports the concept that NPPC is overexpressed because of the loss of a specific negative regulatory control in the normal chromosomal location, and demonstrates the effectiveness of targeted resequencing in the mapping of breakpoints.
25387261 In achondroplasia, hypochondroplasia, and thanatophoric dysplasia, elevated plasma levels of proCNP products suggest the presence of tissue resistance to CNP.
25096521 CNP effectively attenuated LPS-induced endothelial activation by inhibiting the NF-kappaB and p38 signaling pathways.
More...

AA Sequence

MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSR      1 - 70
LLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC                   71 - 126
//

Text Mined References (89)

PMID Year Title
26980729 2016 Catalytically Active Guanylyl Cyclase B Requires Endoplasmic Reticulum-mediated Glycosylation, and Mutations That Inhibit This Process Cause Dwarfism.
26801306 2016 Responses of cardiac natriuretic peptides after paroxysmal supraventricular tachycardia: ANP surges faster than BNP and CNP.
26485840 2015 CLINICAL SIGNIFICANCE OF SERUM N-TERMINAL PRO C-TYPE NATRIURETIC PEPTIDE IN HEPATITIS C-RELATED CHRONIC LIVER DISEASES.
26459742 2016 Therapeutic effect of CNP on renal osteodystrophy by antagonizing the FGF-23/MAPK pathway.
26307537 2015 C-type natriuretic peptide signalling drives homeostatic effects in human chondrocytes.
25926602 Role of C-type natriuretic peptide in the function of normal human sperm.
25811760 2015 Plasma C-type natriuretic peptide as a predictor for therapeutic response to metoprolol in children with postural tachycardia syndrome.
25808436 2015 C-type natriuretic peptide and its precursor: potential markers in human prostate cancer.
25728306 2015 Skeletal overgrowth syndrome caused by overexpression of C-type natriuretic peptide in a girl with balanced chromosomal translocation, t(1;2)(q41;q37.1).
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
More...