Property Summary

NCBI Gene PubMed Count 93
PubMed Score 740.14
PubTator Score 348.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 4.0e-04
Astrocytoma, Pilocytic -1.100 8.0e-07
fibroadenoma 1.100 2.6e-03
group 4 medulloblastoma -1.300 1.0e-04
medulloblastoma, large-cell -1.100 1.9e-05
posterior fossa group A ependymoma 1.300 1.3e-02
psoriasis -1.100 5.9e-07

Gene RIF (65)

AA Sequence

MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSR      1 - 70
LLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC                   71 - 126
//

Text Mined References (93)

PMID Year Title