Property Summary

NCBI Gene PubMed Count 209
PubMed Score 1297.17
PubTator Score 581.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 6.1e-05
Breast cancer 1.200 5.2e-08
breast carcinoma 1.300 4.7e-02
diabetes mellitus -1.300 3.8e-03
glioblastoma 1.700 2.6e-07
group 4 medulloblastoma 1.100 4.5e-02
intraductal papillary-mucinous carcinoma... 1.200 1.9e-03
intraductal papillary-mucinous neoplasm ... 1.500 6.4e-03
invasive ductal carcinoma 1.200 2.8e-03
juvenile dermatomyositis 1.001 1.7e-11
medulloblastoma, large-cell 1.400 1.7e-05
osteosarcoma 1.764 2.5e-04
ovarian cancer -1.100 3.4e-05
pancreatic cancer 1.200 5.0e-03
pediatric high grade glioma 1.200 8.6e-04
primary pancreatic ductal adenocarcinoma 1.718 8.1e-04
Rheumatoid arthritis -2.300 7.4e-04

Protein-protein Interaction (3)

Gene RIF (150)

AA Sequence

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT      1 - 70
FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY     71 - 140
EEVKDRCTLAEKLGGSAVISLEGKPL                                                141 - 166
//

Text Mined References (225)

PMID Year Title