Property Summary

NCBI Gene PubMed Count 193
Grant Count 559
R01 Count 381
Funding $48,418,057.11
PubMed Score 1212.23
PubTator Score 581.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P23528 B3KUQ1 Q53Y87 Q9UCA2
Symbols CFL
cofilin
HEL-S-15

Gene

PDB

5HVK   5L6W   1Q8G   1Q8X   3J0S   4BEX  

 GO Function (1)

Gene RIF (137)

PMID Text
27003257 Aurora kinase A has a role in inducing papillary thyroid cancer lymph node metastasis by promoting cofilin-1 activity
26996939 analysis of human Cof1, Cof2, and ADF effects on actin filament severing and turnover
26878213 novel roles for actin-depolymerizing factor and cofilin-1 in regulating the remodeling and permeability of epithelial junctions
26639431 Progesterone (P4) increases human astrocytoma cells migration and invasion through its intracellular receptor, and that cofilin activation by P4 is independent of progesterone receptor action.
26558842 Cofilin 1 activation prevents the defects in axon elongation and guidance induced by extracellular alpha-synuclein
26450610 cofilin1 is involved in hypertensive nephropathy by modulating the nuclear translocation of NF-kappaB and the expression of its downstream inflammatory factors in renal tubular epithelial cells
26344167 Cofilin-1 and transgelin may play roles in the carcinogenesis and development of esophageal squamous cell carcinoma
26324884 Chronophin has a role in coordinating cell leading edge dynamics by controlling active cofilin levels
26269174 Actin-modulating protein cofilin is involved in the formation of measles virus ribonucleoprotein complex at the perinuclear region.
26268695 These results indicated that cofilin might be involved in the modulation of Aspergillus fumigatus internalization into type II alveolar epithelial cells through the RhoA-ROCK-LIM kinase pathway.
More...

AA Sequence

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT      1 - 70
FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY     71 - 140
EEVKDRCTLAEKLGGSAVISLEGKPL                                                141 - 166
//

Text Mined References (208)

PMID Year Title
27003257 2016 Aurora kinase A induces papillary thyroid cancer lymph node metastasis by promoting cofilin-1 activity.
26996939 2016 TIRF microscopy analysis of human Cof1, Cof2, and ADF effects on actin filament severing and turnover.
26878213 2016 Actin-Depolymerizing Factor and Cofilin-1 Have Unique and Overlapping Functions in Regulating Intestinal Epithelial Junctions and Mucosal Inflammation.
26639431 2016 Progesterone promotes cell migration, invasion and cofilin activation in human astrocytoma cells.
26558842 2015 Cofilin 1 activation prevents the defects in axon elongation and guidance induced by extracellular alpha-synuclein.
26450610 2015 Cofilin1 is involved in hypertension-induced renal damage via the regulation of NF-?B in renal tubular epithelial cells.
26344167 2015 Expression of Cofilin-1 and Transgelin in Esophageal Squamous Cell Carcinoma.
26324884 2015 Chronophin coordinates cell leading edge dynamics by controlling active cofilin levels.
26269174 2015 Actin-Modulating Protein Cofilin Is Involved in the Formation of Measles Virus Ribonucleoprotein Complex at the Perinuclear Region.
26268695 2015 Evidence for the involvement of cofilin in Aspergillus fumigatus internalization into type II alveolar epithelial cells.
More...