Property Summary

NCBI Gene PubMed Count 59
Grant Count 64
R01 Count 43
Funding $12,905,281.35
PubMed Score 479.22
PubTator Score 235.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 0.002

Synonym

Accession P23526 A8K307 B3KUN3 E1P5P2 F5H737 Q96A36 AdoHcyase
Symbols SAHH
adoHcyase

Gene

PANTHER Protein Class (1)

PDB

1A7A   1LI4   3NJ4   4PFJ   4PGF   4YVF  

Gene RIF (37)

PMID Text
26687445 H19 knockdown activates SAHH, leading to increased DNMT3B-mediated methylation of an lncRNA-encoding gene Nctc1 within the Igf2-H19-Nctc1 locus.
26527160 SAH hydrolase deficiency can remain asymptomatic in childhood, and the disorder can be associated with early onset hepatocellular carcinoma.
25248746 S-adenosylhomocysteine hydrolase is regulated by lysine acetylation
24430301 SAHH can promote apoptosis, inhibit migration and adhesion of ESCC cells suggesting that it may be involved in carcinogenesis of the esophagus.
23079506 A fluorescence-based assay for the measurement of S-adenosylhomocysteine hydrolase activity in biological samples.
22190034 HIV-1 Tat is identified to have a physical interaction with adenosylhomocysteinase (AHCY; SAHH) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 Tat is identified to have a physical interaction with adenosylhomocysteinase (AHCY; SAHH) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22023331 The simulations of ligand-induced transition revealed that the signal of intrasubunit closure dynamics is transmitted to form intersubunit contacts, which in turn invoke a precise alignment of active site.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTL      1 - 70
GAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIH     71 - 140
TKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVM    141 - 210
IAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCID    211 - 280
IILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCA    281 - 350
MGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS    351 - 420
CDGPFKPDHYRY                                                              421 - 432
//

Text Mined References (65)

PMID Year Title
26687445 2015 H19 lncRNA alters DNA methylation genome wide by regulating S-adenosylhomocysteine hydrolase.
26527160 2015 Adult-onset liver disease and hepatocellular carcinoma in S-adenosylhomocysteine hydrolase deficiency.
25416956 2014 A proteome-scale map of the human interactome network.
25248746 2014 Regulation of S-adenosylhomocysteine hydrolase by lysine acetylation.
24430301 2014 Overexpression of S-adenosylhomocysteine hydrolase (SAHH) in esophageal squamous cell carcinoma (ESCC) cell lines: effects on apoptosis, migration and adhesion of cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23079506 2013 A fluorescence-based assay for the measurement of S-adenosylhomocysteine hydrolase activity in biological samples.
More...