Property Summary

NCBI Gene PubMed Count 21
PubMed Score 155.04
PubTator Score 40.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 8.20467925716517E-15
posterior fossa group A ependymoma 1511 2.80856641022682E-11
medulloblastoma 1524 3.61662104081678E-11
atypical teratoid / rhabdoid tumor 4369 5.90415909131917E-11
medulloblastoma, large-cell 6234 4.94190723959255E-8
nasopharyngeal carcinoma 1056 2.09296424053475E-7
primitive neuroectodermal tumor 3031 0.0013097998177285
pediatric high grade glioma 2712 0.00430626170344221
astrocytoma 1493 0.0050313711848344
glioblastoma 5572 0.012102203862021
Endometriosis 535 0.0307749029809971

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma -2.800 0.012
posterior fossa group A ependymoma -3.800 0.000
medulloblastoma -5.200 0.000
astrocytoma -1.800 0.005
atypical teratoid / rhabdoid tumor -5.100 0.000
medulloblastoma, large-cell -4.800 0.000
primitive neuroectodermal tumor -3.400 0.001
non-small cell lung cancer -1.825 0.000
pediatric high grade glioma -2.200 0.004
nasopharyngeal carcinoma -3.500 0.000
Endometriosis -1.469 0.031

Synonym

Accession P23515 E1P659
Symbols OMGP

Gene

OMG

  Ortholog (10)

Gene RIF (5)

PMID Text
21534343 The results do not support a relationship between the OMGP gene and the learning disability phenotype observed in neurofibromatosis type 1.
19034380 Data show that oligodendrocyte-myelin glycoprotein is downregulated in schizophrenia anterior temporal lobe revealed by shotgun proteome analysis.
16425041 Observational study of gene-disease association. (HuGE Navigator)
16425041 novel mutations and novel polymorphisms in coding regions and 5'UTR were detected in patients with with non-syndromic mental retardation
12566166 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEYQILKMSLCLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDL      1 - 70
HNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVL     71 - 140
IKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQS    141 - 210
FDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTV    211 - 280
SGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAA    281 - 350
ATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN    351 - 420
AWKVNASFLLLLNVVVMLAV                                                      421 - 440
//

Text Mined References (21)

PMID Year Title
25109740 2014 TAGLN expression is upregulated in NF1-associated malignant peripheral nerve sheath tumors by hypomethylation in its promoter and subpromoter regions.
21534343 Learning disability and oligodendrocyte myelin glycoprotein (OMGP) gene in neurofibromatosis type 1.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
17335080 2007 Roles of glial p75NTR in axonal regeneration.
16425041 2006 Mutations and novel polymorphisms in coding regions and UTRs of CDK5R1 and OMG genes in patients with non-syndromic mental retardation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12951563 2003 Myelin-associated inhibitors of axonal regeneration in the adult mammalian CNS.
12716421 2003 Oligodendrocyte myelin glycoprotein growth inhibition function requires its conserved leucine-rich repeat domain, not its glycosylphosphatidyl-inositol anchor.
More...