Property Summary

NCBI Gene PubMed Count 21
PubMed Score 162.36
PubTator Score 40.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-02
astrocytoma -1.800 5.0e-03
atypical teratoid / rhabdoid tumor -5.100 5.9e-11
Endometriosis -1.469 3.1e-02
ependymoma -3.300 1.8e-09
glioblastoma -1.300 3.2e-02
group 3 medulloblastoma -4.700 3.3e-07
medulloblastoma, large-cell -4.800 4.9e-08
nasopharyngeal carcinoma -3.500 2.1e-07
non-small cell lung cancer -1.825 8.2e-15
primitive neuroectodermal tumor -3.400 1.3e-03

Gene RIF (5)

AA Sequence

MEYQILKMSLCLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDL      1 - 70
HNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVL     71 - 140
IKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQS    141 - 210
FDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTV    211 - 280
SGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAA    281 - 350
ATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN    351 - 420
AWKVNASFLLLLNVVVMLAV                                                      421 - 440
//

Text Mined References (22)

PMID Year Title