Property Summary

NCBI Gene PubMed Count 21
Grant Count 59
R01 Count 44
Funding $5,436,546.03
PubMed Score 155.04
PubTator Score 40.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma -2.800 0.012
posterior fossa group A ependymoma -3.800 0.000
medulloblastoma -5.200 0.000
astrocytoma -1.800 0.005
atypical teratoid / rhabdoid tumor -5.100 0.000
medulloblastoma, large-cell -4.800 0.000
primitive neuroectodermal tumor -3.400 0.001
non-small cell lung cancer -1.825 0.000
pediatric high grade glioma -2.200 0.004
nasopharyngeal carcinoma -3.500 0.000
Endometriosis -1.469 0.031

Gene RIF (5)

PMID Text
21534343 The results do not support a relationship between the OMGP gene and the learning disability phenotype observed in neurofibromatosis type 1.
19034380 Data show that oligodendrocyte-myelin glycoprotein is downregulated in schizophrenia anterior temporal lobe revealed by shotgun proteome analysis.
16425041 Observational study of gene-disease association. (HuGE Navigator)
16425041 novel mutations and novel polymorphisms in coding regions and 5'UTR were detected in patients with with non-syndromic mental retardation
12566166 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEYQILKMSLCLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDL      1 - 70
HNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVL     71 - 140
IKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQS    141 - 210
FDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTV    211 - 280
SGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAA    281 - 350
ATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN    351 - 420
AWKVNASFLLLLNVVVMLAV                                                      421 - 440
//

Text Mined References (21)

PMID Year Title
25109740 2014 TAGLN expression is upregulated in NF1-associated malignant peripheral nerve sheath tumors by hypomethylation in its promoter and subpromoter regions.
21534343 Learning disability and oligodendrocyte myelin glycoprotein (OMGP) gene in neurofibromatosis type 1.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
17335080 2007 Roles of glial p75NTR in axonal regeneration.
16425041 2006 Mutations and novel polymorphisms in coding regions and UTRs of CDK5R1 and OMG genes in patients with non-syndromic mental retardation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12951563 2003 Myelin-associated inhibitors of axonal regeneration in the adult mammalian CNS.
12716421 2003 Oligodendrocyte myelin glycoprotein growth inhibition function requires its conserved leucine-rich repeat domain, not its glycosylphosphatidyl-inositol anchor.
More...