Property Summary

NCBI Gene PubMed Count 80
PubMed Score 106.96
PubTator Score 81.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis -1.347 8.9e-03
adult high grade glioma -1.200 1.4e-03
Astrocytoma, Pilocytic -1.300 6.3e-06
atypical teratoid / rhabdoid tumor 1.500 3.2e-06
colon cancer 1.400 9.0e-04
cystic fibrosis -1.300 4.3e-05
ductal carcinoma in situ 1.300 9.7e-05
glioblastoma 1.500 3.3e-05
group 3 medulloblastoma 1.100 3.1e-03
intraductal papillary-mucinous adenoma (... 1.200 2.0e-04
invasive ductal carcinoma 1.300 8.2e-03
lung cancer 1.400 9.6e-03
malignant mesothelioma 1.100 7.9e-06
medulloblastoma, large-cell 1.600 4.4e-04
osteosarcoma 1.745 2.3e-03
psoriasis -1.200 9.4e-04
urothelial carcinoma 1.200 2.4e-02

 GWAS Trait (1)

Gene RIF (50)

AA Sequence

MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLI      1 - 70
TSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTA     71 - 140
VTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANT    141 - 210
NTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQ    211 - 280
ARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS       281 - 347
//

Text Mined References (83)

PMID Year Title