Property Summary

NCBI Gene PubMed Count 77
Grant Count 5
R01 Count 5
Funding $176,315.64
PubMed Score 102.72
PubTator Score 81.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
urothelial carcinoma 1.200 0.024
malignant mesothelioma 1.500 0.000
psoriasis -1.200 0.001
osteosarcoma 1.745 0.002
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.500 0.000
medulloblastoma 1.500 0.003
medulloblastoma, large-cell 1.600 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.000
lung cancer 1.500 0.007
colon cancer 1.400 0.001
active ulcerative colitis -1.347 0.009
cystic fibrosis -1.300 0.000
adult high grade glioma -1.200 0.001
pilocytic astrocytoma -1.300 0.000
ductal carcinoma in situ 1.300 0.000
invasive ductal carcinoma 1.300 0.008

Synonym

Accession P23511 Q8IXU0
Symbols HAP2
CBF-A
CBF-B
NF-YA

Gene

PANTHER Protein Class (1)

PDB

4AWL  

Gene RIF (47)

PMID Text
26921500 our results indicate that NF-YA alternative splicing is an influential muscle cell determinant, through direct regulation of selected cell cycle blocking genes, and, directly and indirectly, of muscle-specific transcription factors
26732297 A direct non-transcriptional role of NF-Y in the overall efficiency of DNA replication, specifically in the DNA elongation process.
26509926 Presence of NF-Y transcription factor plays a pivotal role in transcriptional regulation of ID genes in development.
26170459 enhanced CDCA8 promoter activities by NF-Y overexpression and reduced CDCA8 transcription by NF-Y knockdown further verified that NF-Y is a positive regulator of CDCA8 transcription.
25756534 NF-Y inhibits NT2/D1 cell growth in p53-independent manner and decreases SOX2 expression.
25473899 Data show that Zinc-fingers and homeoboxes 2 (ZHX2) represses nuclear transcription factor Y alpha (NF-Y)-mediated activation of multidrug resistance 1 (MDR1) transcription.
25463392 Stimulation of the lymphocytes with phytohemagglutinin, restores normal OGG1 levels and repair rates. MAP kinase c-Jun N-terminal kinase (JNK) and the recruitment of the transcription factor NFYA to the promoter region of OGG1 are shown to be involved.
24407240 Association of p21 with NF-YA suppresses the expression of PLK1 and prevents mitotic death in response to DNA damage.
23595228 NF-YA binds directly over the CCAAT sequence.
23332751 The crystal structure of NF-Y bound to a 25 bp CCAAT oligonucleotide shows that the histone-fold domains dimer binds to the DNA sugar-phosphate backbone, mimicking the nucleosome H2A/H2B-DNA assembly; NF-YA both binds to NF-YB/NF-YC and inserts an alpha helix deeply into the DNA minor groove, providing sequence-specific contacts to the CCAAT box.
More...

AA Sequence

MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLI      1 - 70
TSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTA     71 - 140
VTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANT    141 - 210
NTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQ    211 - 280
ARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS       281 - 347
//

Text Mined References (80)

PMID Year Title
26921500 2016 NF-YA splice variants have different roles on muscle differentiation.
26732297 2016 Direct non transcriptional role of NF-Y in DNA replication.
26509926 2015 Epigenetic role of CCAAT box-binding transcription factor NF-Y on ID gene family in human embryonic carcinoma cells.
26170459 2015 Transcriptional activation of human CDCA8 gene regulated by transcription factor NF-Y in embryonic stem cells and cancer cells.
25756534 2015 Transcription factor NF-Y inhibits cell growth and decreases SOX2 expression in human embryonal carcinoma cell line NT2/D1.
25473899 2015 ZHX2 enhances the cytotoxicity of chemotherapeutic drugs in liver tumor cells by repressing MDR1 via interfering with NF-YA.
25463392 2015 The repair of oxidized purines in the DNA of human lymphocytes requires an activation involving NF-YA-mediated upregulation of OGG1.
25416956 2014 A proteome-scale map of the human interactome network.
24407240 2014 Association of p21 with NF-YA suppresses the expression of Polo-like kinase 1 and prevents mitotic death in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...