Property Summary

NCBI Gene PubMed Count 121
PubMed Score 289.15
PubTator Score 183.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 2.400 3.0e-03
hepatocellular carcinoma 1.100 5.2e-03
invasive ductal carcinoma 2.079 1.1e-04
lung cancer -1.200 1.2e-03
lung carcinoma 1.200 1.2e-19
nasopharyngeal carcinoma 1.600 4.2e-04
non-small cell lung cancer 1.020 2.5e-11
ovarian cancer 3.800 3.8e-05
pancreatic cancer 1.100 1.2e-02
pancreatic carcinoma 1.100 1.2e-02

Gene RIF (101)

AA Sequence

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYK      1 - 70
KEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMV     71 - 140
ASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL                               141 - 183
//

Text Mined References (123)

PMID Year Title