Property Summary

NCBI Gene PubMed Count 117
Grant Count 126
R01 Count 82
Funding $10,895,875.19
PubMed Score 271.51
PubTator Score 183.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.005
pancreatic cancer 1.300 0.000
non-small cell lung cancer 1.020 0.000
lung cancer -1.200 0.001
pancreatic carcinoma 1.100 0.012
Breast cancer 2.400 0.003
invasive ductal carcinoma 2.079 0.000
nasopharyngeal carcinoma 1.600 0.000
lung carcinoma 1.200 0.000
ovarian cancer 3.800 0.000

Synonym

Accession P23510 Q5JZA5 Q8IV74 Q9HCN9
Symbols GP34
CD252
OX4OL
TXGP1
CD134L
OX-40L
TNLG2B

Gene

PDB

2HEV  

Gene RIF (97)

PMID Text
27008001 Review/Meta-analysis: TNFSF4 (rs3850641) polymorphisms is not associated with coronary heart disease risk.
26348892 Given the discovery cohort, functional data, and importance of TNFSF4 in infection clearance, TNFSF4C may associate with outcomes and warrants future studies.
26125814 Study showed that the A allele of the rs7518045 and haplotype rs3861950C-rs17346501C-rs7518045A-rs1234313G in the TNFSF4 gene were associated with decreased risk for myocardial infarction in a Chinese Han population.
26070486 contributes to the aberrant T Follicular Helper response in systemic lupus erythematosus
25359291 Data indicate that soluble OX40 and sOX40L plasma levels are increased in early rheumatoid arthritis patients.
24595151 There were no significant associations between rs1234313, rs1234314 and rs17568 and atherosclerotic cerebral infarction risk in a Han Chinese population.
24583911 higher expression in patients with nasal polyposis compared with patients with chronic rhinosinusitis without nasal polyps
24091983 Report role of TNFSF4 genetic variants in confering risk of systemic lupus erythematosus in Chinese population.
23953582 Blocking of the interaction between OX40 and OX40L in vitro inhibited production of Thl and Th2 type cytokines in acute renal allograft rejection.
23948416 The expression levels of OX40 and OX40L were higher in pSS patients.
More...

AA Sequence

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYK      1 - 70
KEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMV     71 - 140
ASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL                               141 - 183
//

Text Mined References (119)

PMID Year Title
27008001 2016 Association of TNFSF4 (rs3850641) gene polymorphisms and coronary heart disease: an evidence-based meta-analysis.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26348892 2016 Analysis of a Genetic Polymorphism in the Costimulatory Molecule TNFSF4 with Hematopoietic Stem Cell Transplant Outcomes.
26125814 2015 Association between TNFSF4 tagSNPs and myocardial infarction in a Chinese Han population.
26070486 2015 OX40 Ligand Contributes to Human Lupus Pathogenesis by Promoting T Follicular Helper Response.
25359291 2014 Soluble OX40L is associated with presence of autoantibodies in early rheumatoid arthritis.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24679586 2014 IL2/IL-4, OX40L and FDC-like cell line support the in vitro tumor cell growth of adult T-cell leukemia/lymphoma.
24595151 2014 Absence of association between atherosclerotic cerebral infarction and TNFSF4/TNFRSF4 single nucleotide polymorphisms rs1234313, rs1234314 and rs17568 in a Chinese population.
24583911 2015 Eosinophilic inflammation of chronic rhinosinusitis with nasal polyps is related to OX40 ligand expression.
More...