Property Summary

NCBI Gene PubMed Count 57
PubMed Score 321.27
PubTator Score 128.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 2.000 3.5e-04
Astrocytoma, Pilocytic 2.300 1.3e-08
Breast cancer -1.300 2.4e-07
cutaneous lupus erythematosus 1.300 2.5e-03
dermatomyositis 1.200 3.8e-02
ependymoma 1.700 1.6e-05
glioblastoma 1.700 7.1e-05
juvenile dermatomyositis 2.268 5.2e-19
lung cancer -2.600 5.7e-04
lung carcinoma -1.300 1.3e-27
Multiple myeloma 1.537 5.1e-03
non-small cell lung cancer -1.096 5.6e-11
osteosarcoma -1.895 7.9e-03
ovarian cancer -1.100 2.5e-03
pituitary cancer -1.900 1.1e-03
psoriasis -2.100 2.3e-04
Rheumatoid arthritis 1.400 2.9e-03
subependymal giant cell astrocytoma 2.568 3.6e-03
ulcerative colitis 1.100 1.1e-05

Gene

PDB

1H5P   4PTB   5FB0   5FB1   5PWE   5PWF   5PWG   5PWH   5PWI   5PWJ   5PWK   5PWL   5PWM   5PWN   5PWO   5PWP   5PWQ   5PWR   5PWS   5PWT   5PWU   5PWV   5PWW   5PWX   5PWY   5PWZ   5PX0   5PX1   5PX2   5PX3   5PX4   5PX5   5PX6   5PX7   5PX8   5PX9   5PXA   5PXB   5PXC   5PXD   5PXE   5PXF   5PXG   5PXH   5PXI   5PXJ   5PXK   5PXL   5PXM   5PXN   5PXO   5PXP   5PXQ   5PXR   5PXS   5PXT   5PXU   5PXV   5PXW   5PXX   5PXY   5PXZ   5PY0   5PY1   5PY2   5PY3   5PY4   5PY5   5PY6   5PY7   5PY8   5PY9   5PYA   5PYB   5PYC   5PYD   5PYE   5PYF   5PYG   5PYH   5PYI   5PYJ   5PYK   5PYL   5PYM   5PYN   5PYO   5PYP   5PYQ   5PYR   5PYS   5PYT   5PYU   5PYV   5PYW   5PYX   5PYY   5PYZ   5PZ0   5PZ1   5PZ2   5PZ3   5PZ4   5PZ5   5PZ6   5PZ7   5PZ8   5PZ9   5PZA   5PZB   5PZC   5PZD   5PZE   5PZF   5PZG   5PZH   5PZI   5PZJ  

Protein-protein Interaction (1)

Gene RIF (29)

AA Sequence

MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKK      1 - 70
TFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLPVLEALFSDVNMQEYPDLIHI     71 - 140
YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCE    141 - 210
TEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELH    211 - 280
NHGIQINSCSVRLVDIKKEKPFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRS    281 - 350
EPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASS    351 - 420
GALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQPQEPENKKCSC    421 - 490
VMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHRSKVNGLQRGRKKDRPRKHLT    491 - 560
LNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINFKQSELPVTCGEVKGTLYKERFKQGTSKKCI    561 - 630
QSEDKKWFTPREFEIEGDRGASKNWKLSIRCGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEE    631 - 700
HKKKNPDASVKFSEFLKKCSETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPK    701 - 770
RPPLAFFLFCSEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKG    771 - 840
KPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK                                   841 - 879
//

Text Mined References (70)

PMID Year Title