Property Summary

NCBI Gene PubMed Count 55
Grant Count 112
R01 Count 75
Funding $9,229,555.26
PubMed Score 307.54
PubTator Score 128.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.003
Multiple myeloma 1.537 0.005
cutaneous lupus erythematosus 1.600 0.001
psoriasis -2.100 0.000
glioblastoma 2.400 0.000
osteosarcoma -2.345 0.001
posterior fossa group A ependymoma 1.900 0.000
juvenile dermatomyositis 2.268 0.000
non-small cell lung cancer -1.096 0.000
lung cancer -4.100 0.000
adult high grade glioma 2.000 0.000
pilocytic astrocytoma 2.300 0.000
subependymal giant cell astrocytoma 2.717 0.001
lung carcinoma -1.300 0.000
ulcerative colitis 1.100 0.000
ovarian cancer 3.000 0.000
Breast cancer -1.300 0.000
pituitary cancer -1.900 0.001
dermatomyositis 1.400 0.024

Gene

PDB

1H5P   5FB0   5FB1  

Gene RIF (27)

PMID Text
26491169 These results suggest that high-risk human papillomavirus 31 target interferon kappa to prevent Sp100 expression and identify Sp100 as an interferon-stimulated gene with anti-human papillomavirus activity.
26057166 PML, hDaxx and Sp100 primarily act as cellular restriction factors during lytic human cytomegalovirus replication and during the dynamic process of reactivation but do not serve as key determinants for the establishment of latency.
24623443 Sp100 depletion promotes Adenovirus progeny production and early viral protein synthesis.
24194542 Sp100 repressed viral transcription and replication only during the initial stages of viral establishment, suggesting that Sp100 acts as a repressor of incoming human papillomavirus type 18 DNA.
24089549 Two regions within the N-terminal of the herpes simplex virus 1 ICP0 facilitate the degradation and dissociation of host PML and dissociation of Sp100 from ND10.
23867815 HIV-1 gp120-treated vaginal epithelial cells show downregulation of SP100 nuclear antigen (SP100) expression as compared to untreated control
23830076 The results suggest that hantavirus infection interferes with DAXX-mediated apoptosis, and expression of interferon-activated Sp100 and ISG-20 proteins may indicate intracellular intrinsic antiviral attempts.
23485562 Sp100 is recruited to activated arrays in cells expressing the herpes simplex virus type 1 E3 ubiquitin ligase, ICP0, which degrades all Sp100 isoforms except unsumoylated Sp100A.
23221561 Authors conclude that several ND10 components, including Daxx, the promyelocytic leukemia (PML) protein, and Sp100 cooperate in an additive manner to regulate herpes simplex virus type 1 and human cytomegalovirus infection.
22419217 SP100 and Adeno-associated virus 2 Rep78 are both located in the nucleolus, which provides the spatial possibility for their interaction.
More...

AA Sequence

MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKK      1 - 70
TFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLPVLEALFSDVNMQEYPDLIHI     71 - 140
YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCE    141 - 210
TEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELH    211 - 280
NHGIQINSCSVRLVDIKKEKPFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRS    281 - 350
EPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASS    351 - 420
GALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQPQEPENKKCSC    421 - 490
VMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHRSKVNGLQRGRKKDRPRKHLT    491 - 560
LNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINFKQSELPVTCGEVKGTLYKERFKQGTSKKCI    561 - 630
QSEDKKWFTPREFEIEGDRGASKNWKLSIRCGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEE    631 - 700
HKKKNPDASVKFSEFLKKCSETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPK    701 - 770
RPPLAFFLFCSEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKG    771 - 840
KPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK                                   841 - 879
//

Text Mined References (67)

PMID Year Title
26491169 2015 Interferon Kappa Inhibits Human Papillomavirus 31 Transcription by Inducing Sp100 Proteins.
26057166 2015 Contribution of the Major ND10 Proteins PML, hDaxx and Sp100 to the Regulation of Human Cytomegalovirus Latency and Lytic Replication in the Monocytic Cell Line THP-1.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24623443 2014 Sp100 isoform-specific regulation of human adenovirus 5 gene expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24194542 2013 Sp100 provides intrinsic immunity against human papillomavirus infection.
24089549 2013 Two overlapping regions within the N-terminal half of the herpes simplex virus 1 E3 ubiquitin ligase ICP0 facilitate the degradation and dissociation of PML and dissociation of Sp100 from ND10.
More...