Property Summary

NCBI Gene PubMed Count 40
PubMed Score 365.55
PubTator Score 179.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis -4.200 1.3e-04
psoriasis -1.700 2.1e-32
periodontitis -1.400 2.8e-09

Gene RIF (21)

AA Sequence

MSYQKKQPTPQPPVDCVKTSGGGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSG      1 - 70
GGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGG     71 - 140
SGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCFSSGGGGGSVCGYSGGGSGCGGGSSGGSGSGYVS    141 - 210
SQQVTQTSCAPQPSYGGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGG    211 - 280
GGGSSVGGSGSGKGVPICHQTQQKQAPTWPSK                                          281 - 312
//

Text Mined References (42)

PMID Year Title