Property Summary

NCBI Gene PubMed Count 63
Grant Count 55
R01 Count 24
Funding $4,529,412.12
PubMed Score 143.98
PubTator Score 86.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 2.200 0.006
oligodendroglioma 2.500 0.002
esophageal adenocarcinoma -1.200 0.024
glioblastoma 1.500 0.000
sonic hedgehog group medulloblastoma -3.600 0.000
medulloblastoma, large-cell -3.100 0.002
non-small cell lung cancer 3.415 0.000
colon cancer -2.000 0.000
interstitial cystitis 1.800 0.001
cystic fibrosis 2.300 0.001
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 2.000 0.000
nasopharyngeal carcinoma -2.000 0.027
breast carcinoma -1.400 0.000
Breast cancer -4.100 0.000
ovarian cancer -4.300 0.000
pituitary cancer -1.700 0.003

Synonym

Accession P23471 A4D0W5 C9JFM0 O76043 Q9UDR6 R-PTP-zeta
Symbols PTPZ
HPTPZ
PTP18
PTPRZ
RPTPB
HPTPzeta
PTP-ZETA
RPTPbeta
phosphacan
R-PTP-zeta-2

Gene

PDB

3S97   3JXF   5AWX  

Gene RIF (43)

PMID Text
26851024 Confirm contribution of PTPRZ1, and especially PTPRQ, in CRC carcinogenesis and demonstrated that PTPRQ expression is correlated with KRAS mutation.
25935522 Data indicate that enhanced MET oncoprotein RNA expression by fusion with receptor-type tyrosine-protein phosphatase zeta (PTPRZ1).
25238264 Distinct domains of PTPRZ-B are differentially required for migration and proliferation of glioma cells, respectively.
25135958 Data indicate that the fusion arose from translocation events involving introns 3 or 8 of protein tyrosine phosphatase, receptor-type, Z polypeptide 1 (PTPRZ1) and intron 1 of hepatocyte growth factor receptor MET.
24242166 High expression of PTP receptors R and Z1 was observed in all examined cases of colorectal carcinoma, adenoma and normal colon tissue in this study.
23777859 Ligand independent activation of anaplastic lymphoma kinase (ALK) results when the cytokine pleiotrophin (PTN) interacts with its receptor, the receptor protein tyrosine phosphatase beta-zeta (RPTPbeta-zeta). Review)
23744080 Data suggest that CSF-1R-independent actions of IL-34 via receptor-type protein-tyrosine phosphatase zeta (PTP-zeta) might be considered in evaluating IL-34 roles in development and disease.
23588815 Protein tyrosine phosphatase zeta enhances proliferation by increasing beta-catenin nuclear expression in VHL-inactive human renal cell carcinoma cells.
23570448 PTPRZ1 is affected in a contiguous gene deletion syndrome
23226095 Receptor-type Protein tyrosine phosphatase beta regulates met phosphorylation and function in head and neck squamous cell carcinoma.
More...

AA Sequence

MRILKRFLACIQLLCVCRLDWANGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDL      1 - 70
TQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGS     71 - 140
EHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQA    141 - 210
ALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDY    211 - 280
LQNNFREQQYKFSRQVFSSYTGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLY    281 - 350
QQLDGEDQTKHEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGKYSDQLIVDMPTDNPELDLFPE    351 - 420
LIGTEEIIKEEEEGKDIEEGAIVNPGRDSATNQIRKKEPQISTTTHYNRIGTKYNEAKTNRSPTRGSEFS    421 - 490
GKGDVPNTSLNSTSQPVTKLATEKDISLTSQTVTELPPHTVEGTSASLNDGSKTVLRSPHMNLSGTAESL    491 - 560
NTVSITEYEEESLLTSFKLDTGAEDSSGSSPATSAIPFISENISQGYIFSSENPETITYDVLIPESARNA    561 - 630
SEDSTSSGSEESLKDPSMEGNVWFPSSTDITAQPDVGSGRESFLQTNYTEIRVDESEKTTKSFSAGPVMS    631 - 700
QGPSVTDLEMPHYSTFAYFPTEVTPHAFTPSSRQQDLVSTVNVVYSQTTQPVYNGETPLQPSYSSEVFPL    701 - 770
VTPLLLDNQILNTTPAASSSDSALHATPVFPSVDVSFESILSSYDGAPLLPFSSASFSSELFRHLHTVSQ    771 - 840
ILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLYKTLMFSQVEP    841 - 910
PSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQGSLFSGPSHIPIPKSSLITPT    911 - 980
ASLLQPTHALSGDGEWSGASSDSEFLLPDTDGLTALNISSPVSVAEFTYTTSVFGDDNKALSKSEIIYGN    981 - 1050
ETELQIPSFNEMVYPSESTVMPNMYDNVNKLNASLQETSVSISSTKGMFPGSLAHTTTKVFDHEISQVPE   1051 - 1120
NNFSVQPTHTVSQASGDTSLKPVLSANSEPASSDPASSEMLSPSTQLLFYETSASFSTEVLLQPSFQASD   1121 - 1190
VDTLLKTVLPAVPSDPILVETPKVDKISSTMLHLIVSNSASSENMLHSTSVPVFDVSPTSHMHSASLQGL   1191 - 1260
TISYASEKYEPVLLKSESSHQVVPSLYSNDELFQTANLEINQAHPPKGRHVFATPVLSIDEPLNTLINKL   1261 - 1330
IHSDEILTSTKSSVTGKVFAGIPTVASDTFVSTDHSVPIGNGHVAITAVSPHRDGSVTSTKLLFPSKATS   1331 - 1400
ELSHSAKSDAGLVGGGEDGDTDDDGDDDDDDRGSDGLSIHKCMSCSSYRESQEKVMNDSDTHENSLMDQN   1401 - 1470
NPISYSLSENSEEDNRVTSVSSDSQTGMDRSPGKSPSANGLSQKHNDGKEENDIQTGSALLPLSPESKAW   1471 - 1540
AVLTSDEESGSGQGTSDSLNENETSTDFSFADTNEKDADGILAAGDSEITPGFPQSPTSSVTSENSEVFH   1541 - 1610
VSEAEASNSSHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTSPR   1611 - 1680
VISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQSCTVDLGITADSSNHPDN   1681 - 1750
KHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNV   1751 - 1820
EVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRV   1821 - 1890
VTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVN   1891 - 1960
IFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLL   1961 - 2030
SQSNIQQSDYSAALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPLL   2031 - 2100
HTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEHKCLSNEEKLIIQDF   2101 - 2170
ILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLM   2171 - 2240
HQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVILSLVSTRQEENPSTSLDSNGAALPDGNIAES   2241 - 2310
LESLV                                                                    2311 - 2315
//

Text Mined References (66)

PMID Year Title
26851024 2016 High PTPRQ Expression and Its Relationship to Expression of PTPRZ1 and the Presence of KRAS Mutations in Colorectal Cancer Tissues.
25935522 2015 Enhanced expression and phosphorylation of the MET oncoprotein by glioma-specific PTPRZ1-MET fusions.
25238264 2014 Intracellular and extracellular domains of protein tyrosine phosphatase PTPRZ-B differentially regulate glioma cell growth and motility.
25135958 2014 RNA-seq of 272 gliomas revealed a novel, recurrent PTPRZ1-MET fusion transcript in secondary glioblastomas.
24242166 2014 Immunohistochemical and Western blot analysis of two protein tyrosine phosphatase receptors, R and Z1, in colorectal carcinoma, colon adenoma and normal colon tissues.
23777859 2013 Anaplastic lymphoma kinase: "Ligand Independent Activation" mediated by the PTN/RPTP?/? signaling pathway.
23744080 2013 Receptor-type protein-tyrosine phosphatase ? is a functional receptor for interleukin-34.
23588815 2013 Protein tyrosine phosphatase ? enhances proliferation by increasing ?-catenin nuclear expression in VHL-inactive human renal cell carcinoma cells.
23570448 2013 Genetic basis of hyperlysinemia.
23226095 2012 Receptor-type Protein tyrosine phosphatase ? regulates met phosphorylation and function in head and neck squamous cell carcinoma.
More...