Property Summary

NCBI Gene PubMed Count 42
Grant Count 18
R01 Count 15
Funding $3,227,827.38
PubMed Score 43.52
PubTator Score 43.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Gene RIF (22)

PMID Text
25775014 Results demonstrate that PTPRG plasmatic form (sPTPRG) represent a novel candidate protein biomarker in plasma whose increased expression is associated to hepatocyte damage.
25624455 PTPRG is a JAK2 phosphatase that negatively regulates leukocyte integrin beta2 activation.
25299301 SNPs in PTPRG were not associated with FCD in Caucasians.
25196286 Germline polymorphisms in PTPRG gene is associated with lung adenocarcinoma.
25158255 Mutations in PDGFRB cause infantile myofibromatosis while a mutation in PTPRG may act as an aggravating factor.
24496747 PTPRG expression induces dephosphorylation of ERK, a downstream RAS target that may be critical for mutant RAS-induced cell growth.
23758498 Our results showed that there was no significant association between any of five reported SNPs of TCF4 and PTPRG genes and the occurrence of Fuchs' endothelial dystrophy; only rs7640737 in PTPRG showed an increased risk for corneal dystrophy.
21795790 found that the RPTP-gamma, RPTP-gamma(V948I, S970T) and RPTP-gamma(C858S, S970T) proteins could be stored at 193 K in their respective crystallization buffers without affecting crystallization or crystal quality
21150880 Tumor-specific methylation of the first intron of the receptor protein-tyrosine phosphatase gamma gene was found in both sporadic and Lynch syndrome colorectal cancers.
20959494 Downregulation of Protein tyrosine phosphatase receptor type {gamma} is associated with chronic myeloid leukemia.
More...

AA Sequence

MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEH      1 - 70
WVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVSGAGLP     71 - 140
GRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQVSPRD    141 - 210
NSALDPIIHGLKGVVHHEKETFLDPFVLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQ    211 - 280
LEAFYSIFTTEQQDHVKSVEYLRNNFRPQQRLHDRVVSKSAVRDSWNHDMTDFLENPLGTEASKVCSSPP    281 - 350
IHMKVQPLNQTALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL    351 - 420
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTWTSSGIPFSFV    421 - 490
SMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPTAASASKQAARPVLATTEALA    491 - 560
SPGPDGDSSPTKDGEGTEEGEKDEKSESEDGEREHEEDGEKDSEKKEKSGVTHAAEERNQTEPSPTPSSP    561 - 630
NRTAEGGHQTIPGHEQDHTAVPTDQTGGRRDAGPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKP    631 - 700
MSRGDRFSEDSRFITVNPAEKNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKS    701 - 770
KGFPRRFREVPSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL    771 - 840
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINAN    841 - 910
YVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTL    911 - 980
KSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARM    981 - 1050
PETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAI   1051 - 1120
LGKETEVSSNQLHSYVNSILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERA   1121 - 1190
RVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF   1191 - 1260
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTF   1261 - 1330
ELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQY   1331 - 1400
QFIYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAESMESLV                            1401 - 1445
//

Text Mined References (46)

PMID Year Title
25775014 2015 Identification of protein tyrosine phosphatase receptor gamma extracellular domain (sPTPRG) as a natural soluble protein in plasma.
25624455 2015 Protein tyrosine phosphatase receptor type ? is a JAK phosphatase and negatively regulates leukocyte integrin activation.
25299301 2014 Association of common variants in TCF4 and PTPRG with Fuchs' corneal dystrophy: a systematic review and meta-analysis.
25196286 2015 Germline polymorphisms and survival of lung adenocarcinoma patients: a genome-wide study in two European patient series.
25158255 2014 Modulation of expressivity in PDGFRB-related infantile myofibromatosis: a role for PTPRG?
24496747 2014 PTPRG inhibition by DNA methylation and cooperation with RAS gene activation in childhood acute lymphoblastic leukemia.
23758498 2014 Association of transcription factor 4 (TCF4) and protein tyrosine phosphatase, receptor type G (PTPRG) with corneal dystrophies in southern Chinese.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
More...