Property Summary

Ligand Count 1
NCBI Gene PubMed Count 45
PubMed Score 47.39
PubTator Score 43.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.192 7.3e-03
active ulcerative colitis 1.318 4.8e-03
acute quadriplegic myopathy 1.174 5.5e-08
adrenocortical carcinoma -1.249 8.5e-03
aldosterone-producing adenoma -1.118 1.5e-02
astrocytic glioma 1.700 2.6e-02
Astrocytoma, Pilocytic 1.200 1.1e-03
atypical teratoid / rhabdoid tumor 1.100 4.0e-04
Breast cancer 3.100 2.7e-02
cystic fibrosis and chronic rhinosinusit... 1.172 2.5e-02
ductal carcinoma in situ -1.100 6.9e-03
ependymoma 2.300 4.0e-03
gastric carcinoma 1.600 2.0e-02
interstitial cystitis 1.500 2.9e-04
invasive ductal carcinoma -1.300 5.5e-03
lung cancer -1.800 1.7e-03
medulloblastoma 1.100 2.2e-02
medulloblastoma, large-cell 1.300 1.4e-04
non-small cell lung cancer -1.281 1.8e-12
oligodendroglioma 1.700 8.6e-03
osteosarcoma 2.695 9.0e-05
ovarian cancer 2.500 4.2e-05
Pick disease 1.900 1.2e-07
pituitary cancer -1.300 1.7e-05
progressive supranuclear palsy 1.500 5.6e-03
subependymal giant cell astrocytoma 2.198 1.7e-02

Gene RIF (24)

AA Sequence

MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEH      1 - 70
WVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVSGAGLP     71 - 140
GRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQVSPRD    141 - 210
NSALDPIIHGLKGVVHHEKETFLDPFVLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQ    211 - 280
LEAFYSIFTTEQQDHVKSVEYLRNNFRPQQRLHDRVVSKSAVRDSWNHDMTDFLENPLGTEASKVCSSPP    281 - 350
IHMKVQPLNQTALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL    351 - 420
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTWTSSGIPFSFV    421 - 490
SMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPTAASASKQAARPVLATTEALA    491 - 560
SPGPDGDSSPTKDGEGTEEGEKDEKSESEDGEREHEEDGEKDSEKKEKSGVTHAAEERNQTEPSPTPSSP    561 - 630
NRTAEGGHQTIPGHEQDHTAVPTDQTGGRRDAGPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKP    631 - 700
MSRGDRFSEDSRFITVNPAEKNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKS    701 - 770
KGFPRRFREVPSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL    771 - 840
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINAN    841 - 910
YVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTL    911 - 980
KSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARM    981 - 1050
PETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAI   1051 - 1120
LGKETEVSSNQLHSYVNSILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERA   1121 - 1190
RVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF   1191 - 1260
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTF   1261 - 1330
ELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQY   1331 - 1400
QFIYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAESMESLV                            1401 - 1445
//

Text Mined References (49)

PMID Year Title