Property Summary

NCBI Gene PubMed Count 42
PubMed Score 43.52
PubTator Score 43.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Stomach Neoplasms 282
Disease Target Count P-value
non-small cell lung cancer 2798 1.76752752062536E-12
ulcerative colitis 2087 1.20646335153014E-7
Pick disease 1893 1.215240084865E-7
osteosarcoma 7933 2.68833571499161E-7
acute quadriplegic myopathy 1157 7.40771556764323E-6
ovarian cancer 8492 4.19194475107238E-5
medulloblastoma, large-cell 6234 1.39215439920871E-4
interstitial cystitis 2299 2.90485697618098E-4
atypical teratoid / rhabdoid tumor 4369 3.98601934056645E-4
pilocytic astrocytoma 3086 0.00120620953963603
lung cancer 4473 0.00172819297422891
invasive ductal carcinoma 2950 0.00285015617846349
ependymoma 2514 0.00398236738217175
pituitary cancer 1972 0.00447071228502125
progressive supranuclear palsy 674 0.00561839850819653
ductal carcinoma in situ 1745 0.0068981658579911
active Crohn's disease 918 0.0073406230672252
adrenocortical carcinoma 1427 0.00848505169276283
oligodendroglioma 2849 0.0086475771048471
aldosterone-producing adenoma 664 0.0151138926539632
subependymal giant cell astrocytoma 2287 0.0165423459957572
gastric carcinoma 832 0.0195186817420537
medulloblastoma 1524 0.0218674258819771
cystic fibrosis and chronic rhinosinusitis 213 0.0254678892845323
astrocytic glioma 2241 0.0262244486812119
Breast cancer 3099 0.0270162221104319
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (26)

Synonym

Accession P23470 B2RU12 B7ZLX5 Q15623 Q59EE0 Q68DU5 Protein-tyrosine phosphatase gamma
Symbols PTPG
HPTPG
RPTPG
R-PTP-GAMMA

Gene

PDB

2H4V   2HY3   2NLK   2PBN   3JXH   3QCB   3QCC   3QCD   3QCE   3QCF   3QCG   3QCH   3QCI   3QCJ   3QCK   3QCL   3QCM   3QCN   5E5R  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Pathway (1)

Gene RIF (22)

PMID Text
25775014 Results demonstrate that PTPRG plasmatic form (sPTPRG) represent a novel candidate protein biomarker in plasma whose increased expression is associated to hepatocyte damage.
25624455 PTPRG is a JAK2 phosphatase that negatively regulates leukocyte integrin beta2 activation.
25299301 SNPs in PTPRG were not associated with FCD in Caucasians.
25196286 Germline polymorphisms in PTPRG gene is associated with lung adenocarcinoma.
25158255 Mutations in PDGFRB cause infantile myofibromatosis while a mutation in PTPRG may act as an aggravating factor.
24496747 PTPRG expression induces dephosphorylation of ERK, a downstream RAS target that may be critical for mutant RAS-induced cell growth.
23758498 Our results showed that there was no significant association between any of five reported SNPs of TCF4 and PTPRG genes and the occurrence of Fuchs' endothelial dystrophy; only rs7640737 in PTPRG showed an increased risk for corneal dystrophy.
21795790 found that the RPTP-gamma, RPTP-gamma(V948I, S970T) and RPTP-gamma(C858S, S970T) proteins could be stored at 193 K in their respective crystallization buffers without affecting crystallization or crystal quality
21150880 Tumor-specific methylation of the first intron of the receptor protein-tyrosine phosphatase gamma gene was found in both sporadic and Lynch syndrome colorectal cancers.
20959494 Downregulation of Protein tyrosine phosphatase receptor type {gamma} is associated with chronic myeloid leukemia.
More...

AA Sequence

MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEH      1 - 70
WVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVSGAGLP     71 - 140
GRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQVSPRD    141 - 210
NSALDPIIHGLKGVVHHEKETFLDPFVLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQ    211 - 280
LEAFYSIFTTEQQDHVKSVEYLRNNFRPQQRLHDRVVSKSAVRDSWNHDMTDFLENPLGTEASKVCSSPP    281 - 350
IHMKVQPLNQTALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL    351 - 420
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTWTSSGIPFSFV    421 - 490
SMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPTAASASKQAARPVLATTEALA    491 - 560
SPGPDGDSSPTKDGEGTEEGEKDEKSESEDGEREHEEDGEKDSEKKEKSGVTHAAEERNQTEPSPTPSSP    561 - 630
NRTAEGGHQTIPGHEQDHTAVPTDQTGGRRDAGPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKP    631 - 700
MSRGDRFSEDSRFITVNPAEKNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKS    701 - 770
KGFPRRFREVPSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL    771 - 840
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINAN    841 - 910
YVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTL    911 - 980
KSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARM    981 - 1050
PETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAI   1051 - 1120
LGKETEVSSNQLHSYVNSILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERA   1121 - 1190
RVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF   1191 - 1260
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTF   1261 - 1330
ELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQY   1331 - 1400
QFIYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAESMESLV                            1401 - 1445
//

Text Mined References (46)

PMID Year Title
25775014 2015 Identification of protein tyrosine phosphatase receptor gamma extracellular domain (sPTPRG) as a natural soluble protein in plasma.
25624455 2015 Protein tyrosine phosphatase receptor type ? is a JAK phosphatase and negatively regulates leukocyte integrin activation.
25299301 2014 Association of common variants in TCF4 and PTPRG with Fuchs' corneal dystrophy: a systematic review and meta-analysis.
25196286 2015 Germline polymorphisms and survival of lung adenocarcinoma patients: a genome-wide study in two European patient series.
25158255 2014 Modulation of expressivity in PDGFRB-related infantile myofibromatosis: a role for PTPRG?
24496747 2014 PTPRG inhibition by DNA methylation and cooperation with RAS gene activation in childhood acute lymphoblastic leukemia.
23758498 2014 Association of transcription factor 4 (TCF4) and protein tyrosine phosphatase, receptor type G (PTPRG) with corneal dystrophies in southern Chinese.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
More...