Property Summary

NCBI Gene PubMed Count 42
PubMed Score 48.62
PubTator Score 18.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung carcinoma 2844 1.07197330391289E-28
psoriasis 6685 1.54444801977561E-13
non-small cell lung cancer 2798 3.82879196686897E-12
ovarian cancer 8492 9.34188460443891E-12
group 4 medulloblastoma 1875 6.2062719572017E-10
malignant mesothelioma 3163 7.14948647809537E-9
pilocytic astrocytoma 3086 8.47713567111965E-9
posterior fossa group A ependymoma 1511 1.09065356009211E-8
atypical teratoid / rhabdoid tumor 4369 4.45622494182558E-6
Breast cancer 3099 5.10937060923565E-6
medulloblastoma, large-cell 6234 1.22530963480852E-5
primary Sjogren syndrome 789 8.23975858301664E-4
tuberculosis 1563 0.00123292631181393
pituitary cancer 1972 0.00145852190335935
interstitial cystitis 2299 0.00228783848198544
osteosarcoma 7933 0.00578520308327057
gastric carcinoma 832 0.0182998999692415

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -4.200 0.000
osteosarcoma -1.745 0.006
posterior fossa group A ependymoma -1.500 0.000
group 4 medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -2.400 0.000
tuberculosis 1.100 0.001
non-small cell lung cancer -1.420 0.000
interstitial cystitis 1.100 0.002
pilocytic astrocytoma 1.800 0.000
primary Sjogren syndrome 1.200 0.001
Breast cancer -1.300 0.000
psoriasis 1.200 0.000
lung carcinoma -2.100 0.000
gastric carcinoma 1.400 0.018
ovarian cancer -2.500 0.000
pituitary cancer -1.400 0.001

Synonym

Accession P23469 Q13345 Q5VWH3 Q5VWH4 Q96KQ6 Protein-tyrosine phosphatase epsilon
Symbols PTPE
HPTPE
R-PTP-EPSILON

Gene

PDB

2JJD  

  Ortholog (11)

 GWAS Trait (1)

Gene RIF (14)

PMID Text
22117074 Epidermal growth factor receptor (EGFR)-mediated positive feedback of protein-tyrosine phosphatase epsilon (PTPepsilon) on ERK1/2 and AKT protein pathways is required for survival of human breast cancer cells.
21734400 Studies indicate that RAD50 and PTPRE of crude associations with asthma at a Bonferroni-corrected level of significance, while IL4R, CCL5 and TBXA2R of nominal significance.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies PTPRE, a member of the protein tyrosine phosphatase family, is important for HIV-1 replication
18682798 Observational study of gene-disease association. (HuGE Navigator)
18093973 Protein-tyrosine phosphatase epsilon regulates Shc signaling in a kinase-specific manner: increasing coherence in tyrosine phosphatase signaling
16385451 Observational study of gene-disease association. (HuGE Navigator)
15390114 Transgenic mice overexpressing catalytically inactive transmembrane protein tyrosine phosphatase epsilon provide unexpected insight into the cell-cell interactions that occur between oligodendrocytes and the cells which they myelinate.
12861030 cyt-PTP epsilon is dimerized and phosphorylated in the absence of direct interaction between the PTP and extracellular molecules
More...

AA Sequence

MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFR      1 - 70
FRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFN     71 - 140
SLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGP    141 - 210
KQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQ    211 - 280
PQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTGTFIVIDA    281 - 350
MMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLEKHLQTMHGTTTH    351 - 420
FDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEYTDYINASFIDGY    421 - 490
RQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTL    491 - 560
SEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQQQTGNHPITVHC    561 - 630
SAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK    631 - 700
//

Text Mined References (46)

PMID Year Title
25772781 2015 Linkage and association analysis of obesity traits reveals novel loci and interactions with dietary n-3 fatty acids in an Alaska Native (Yup'ik) population.
23440723 2013 Deregulation of protein phosphatase expression in acute myeloid leukemia.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22117074 2012 Epidermal growth factor receptor (EGFR)-mediated positive feedback of protein-tyrosine phosphatase epsilon (PTPepsilon) on ERK1/2 and AKT protein pathways is required for survival of human breast cancer cells.
21734400 2011 Attempted replication of 50 reported asthma risk genes identifies a SNP in RAD50 as associated with childhood atopic asthma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
18682798 2008 Genes to diseases (G2D) computational method to identify asthma candidate genes.
More...