Property Summary

NCBI Gene PubMed Count 43
PubMed Score 55.08
PubTator Score 18.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic 1.800 6.0e-09
atypical teratoid / rhabdoid tumor -1.800 4.5e-06
Breast cancer 1.100 2.1e-02
ependymoma -1.400 1.4e-05
gastric carcinoma 1.400 1.8e-02
group 3 medulloblastoma -2.000 2.8e-06
interstitial cystitis 1.100 2.3e-03
lung carcinoma -2.100 1.1e-28
malignant mesothelioma -4.200 7.1e-09
medulloblastoma, large-cell -2.400 1.2e-05
non-small cell lung cancer -1.420 3.8e-12
osteosarcoma -1.683 1.7e-04
ovarian cancer -2.500 9.3e-12
pituitary cancer -1.400 1.5e-03
primary Sjogren syndrome 1.200 8.2e-04
psoriasis 1.200 1.5e-13
tuberculosis 1.100 1.2e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFR      1 - 70
FRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFN     71 - 140
SLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGP    141 - 210
KQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQ    211 - 280
PQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTGTFIVIDA    281 - 350
MMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLEKHLQTMHGTTTH    351 - 420
FDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEYTDYINASFIDGY    421 - 490
RQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTL    491 - 560
SEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQQQTGNHPITVHC    561 - 630
SAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK    631 - 700
//

Text Mined References (47)

PMID Year Title