Property Summary

NCBI Gene PubMed Count 76
Grant Count 21
R01 Count 8
Funding $2,441,711.41
PubMed Score 186.06
PubTator Score 78.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (49)

PMID Text
26425837 PTPRD was identified as a novel locus potentially associated with blood pressure response to atenolol and resistant hypertension in multiple ethnic groups.
26267899 PTPRD mutation, but not methylation or copy number loss, may serve as a predictive biomarker of sensitivity to STAT3 inhibitors in HNSCC.
26079428 Study shows for the first time that DNMT1 caused PTPRD DNA hypermethylation and induced insulin signaling silencing in T2D patients.
25831062 PTPRD is homozygously deleted and epigenetically downregulated in hepatocellular carcinomas (HCCs).
25412184 Silencing PTPRD expression by siRNA treatment significantly enhanced cell proliferation compared with mock siRNA treatment.
25345593 This study demonstrated that the copy number variations of PTPRD relate to opioid dependence.
25287652 The absence of MIM led to PTPdelta-mediated activation of SRC.
25142570 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD
25138050 Ptprd is a tumor suppressor that can promote tumorigenesis in concert with Cdkn2a loss.
25113440 we report desmoplakin, a desmosomal protein that is implicated in cell-cell adhesion, as a novel PTPRD substrate.
More...

AA Sequence

MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFE      1 - 70
VIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQIPRGFPTIDMGPQLKVVERT     71 - 140
RTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVAT    141 - 210
NSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED    211 - 280
DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEP    281 - 350
VSYYIIQHKPKNSEELYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA    351 - 420
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSV    421 - 490
KVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQ    491 - 560
RITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSW    561 - 630
QPPPVEKQNGIITEYSIKYTAVDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESL    631 - 700
SVLIRTNEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVML    701 - 770
ADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL    771 - 840
IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNKVGFGEEMVKE    841 - 910
ISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMT    911 - 980
LTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYNSAMPF    981 - 1050
KILYDDGKMVEEVDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNL   1051 - 1120
DGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKP   1121 - 1190
YIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI   1191 - 1260
TDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNNKEIPSHHPTDPVELRRLNFQTPG   1261 - 1330
MASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLS   1331 - 1400
AIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP   1401 - 1470
SRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKT   1471 - 1540
CNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALL   1541 - 1610
EAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP   1611 - 1680
YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMG   1681 - 1750
REKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGF   1751 - 1820
IDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTE   1821 - 1890
DQYQFSYRAALEYLGSFDHYAT                                                   1891 - 1912
//

Text Mined References (80)

PMID Year Title
26425837 2015 PTPRD gene associated with blood pressure response to atenolol and resistant hypertension.
26267899 2015 Loss-of-Function PTPRD Mutations Lead to Increased STAT3 Activation and Sensitivity to STAT3 Inhibition in Head and Neck Cancer.
26079428 2015 PTPRD silencing by DNA hypermethylation decreases insulin receptor signaling and leads to type 2 diabetes.
25831062 2015 PTPRD is homozygously deleted and epigenetically downregulated in human hepatocellular carcinomas.
25412184 2014 Reduced expression of PTPRD correlates with poor prognosis in gastric adenocarcinoma.
25345593 2015 Genome-wide association study of copy number variations (CNVs) with opioid dependence.
25287652 2015 Missing-in-Metastasis regulates cell motility and invasion via PTP?-mediated changes in SRC activity.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25142570 2014 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD.
25138050 2014 Deletion of Ptprd and Cdkn2a cooperate to accelerate tumorigenesis.
More...