Property Summary

NCBI Gene PubMed Count 82
PubMed Score 199.34
PubTator Score 78.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (25)

Disease log2 FC p
lung cancer -1.700 2.1e-03
Breast cancer 1.100 3.0e-02
acute myeloid leukemia -1.200 6.7e-03
adult high grade glioma -1.300 3.3e-03
atypical teratoid / rhabdoid tumor 1.500 3.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.230 6.1e-03
colon cancer -2.800 1.0e-02
Down syndrome 1.100 4.0e-03
ependymoma -1.900 5.0e-06
facioscapulohumeral dystrophy 1.800 3.0e-02
glioblastoma -2.000 9.2e-06
group 4 medulloblastoma -1.200 3.2e-02
Hydrolethalus syndrome -1.094 4.8e-02
interstitial cystitis -1.200 3.5e-03
intraductal papillary-mucinous adenoma (... -2.400 4.9e-04
lung adenocarcinoma -1.200 3.0e-12
malignant mesothelioma 1.100 1.9e-03
medulloblastoma, large-cell -2.200 5.2e-03
non-small cell lung carcinoma -1.300 6.4e-29
osteosarcoma 2.259 1.9e-02
ovarian cancer -1.500 1.3e-03
pituitary cancer -2.000 1.1e-02
psoriasis -2.600 5.1e-03
subependymal giant cell astrocytoma -1.707 1.9e-02
ulcerative colitis -1.014 1.3e-02

 CSPA Cell Line (2)

Protein-protein Interaction (2)

Gene RIF (55)

AA Sequence

MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFE      1 - 70
VIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQIPRGFPTIDMGPQLKVVERT     71 - 140
RTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVAT    141 - 210
NSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED    211 - 280
DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEP    281 - 350
VSYYIIQHKPKNSEELYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA    351 - 420
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSV    421 - 490
KVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQ    491 - 560
RITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSW    561 - 630
QPPPVEKQNGIITEYSIKYTAVDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESL    631 - 700
SVLIRTNEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVML    701 - 770
ADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL    771 - 840
IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNKVGFGEEMVKE    841 - 910
ISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMT    911 - 980
LTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYNSAMPF    981 - 1050
KILYDDGKMVEEVDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNL   1051 - 1120
DGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKP   1121 - 1190
YIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI   1191 - 1260
TDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNNKEIPSHHPTDPVELRRLNFQTPG   1261 - 1330
MASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLS   1331 - 1400
AIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP   1401 - 1470
SRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKT   1471 - 1540
CNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALL   1541 - 1610
EAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP   1611 - 1680
YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMG   1681 - 1750
REKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGF   1751 - 1820
IDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTE   1821 - 1890
DQYQFSYRAALEYLGSFDHYAT                                                   1891 - 1912
//

Text Mined References (86)

PMID Year Title