Property Summary

NCBI Gene PubMed Count 42
PubMed Score 106.47
PubTator Score 51.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Hemangiosarcoma 18
Disease Target Count P-value
non-small cell lung cancer 2798 2.47073302766194E-30
lung adenocarcinoma 2714 2.54083898290128E-21
lung carcinoma 2844 2.78452450383634E-13
breast carcinoma 1614 1.53698235726513E-12
lung cancer 4473 2.51899707870819E-6
adrenocortical carcinoma 1427 6.59521068576123E-6
Breast cancer 3099 1.17507203694656E-5
osteosarcoma 7933 9.92433960571926E-5
cystic fibrosis 1670 1.64379816183738E-4
invasive ductal carcinoma 2950 2.32845815820973E-4
ductal carcinoma in situ 1745 3.97666322804614E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00118454031595946
nephrosclerosis 329 0.00177009113609574
medulloblastoma, large-cell 6234 0.00220103182806968
adult high grade glioma 2148 0.00832364841734471
atypical teratoid/rhabdoid tumor 1095 0.0290371958684439
acute myeloid leukemia 785 0.0346446043287942
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Hyperkalemic periodic paralysis 10 3.609 1.8

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis 1.091 0.002
osteosarcoma -1.627 0.000
cystic fibrosis 1.623 0.000
medulloblastoma, large-cell -1.500 0.002
adrenocortical carcinoma -2.186 0.000
pancreatic ductal adenocarcinoma liver m... -2.160 0.001
non-small cell lung cancer -3.538 0.000
lung cancer -3.600 0.000
lung adenocarcinoma -2.700 0.000
adult high grade glioma -1.100 0.008
atypical teratoid/rhabdoid tumor -1.100 0.029
acute myeloid leukemia -1.400 0.035
lung carcinoma -2.500 0.000
breast carcinoma -1.100 0.000
Breast cancer 1.300 0.000
ductal carcinoma in situ -1.700 0.000
invasive ductal carcinoma -2.600 0.000

Synonym

Accession P23467 B7ZKS8 B7ZKT0 C9JX87 F5H3G6 Q14D85 Q3MIV7 Protein-tyrosine phosphatase beta
Symbols PTPB
HPTPB
VEPTP
HPTP-BETA
R-PTP-BETA

Gene

PDB

2AHS   2H02   2H03   2H04   2HC1   2HC2   2I3R   2I3U   2I4E   2I4G   2I4H   2I5X  

  Ortholog (11)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

 CSPA Cell Line (3)

Gene RIF (15)

PMID Text
25180601 VE-PTP activates TIE2 and stabilizes retinal and choroidal blood vessels
24965120 HIV-1 Tat C treated human brain microvascular endothelial cells result in downregulation and dissociation of VE-PTP and SHP2 from VE-cadherin
24795022 Results provide evidence that PTPRB and PLCG1 mutations are driving events in a subset of secondary angiosarcomas.
24633157 The endothelial phosphatase PTPRB, a negative regulator of vascular growth factor tyrosine kinases, harbored predominantly truncating mutations in 10 of 39 angiosarcoma tumors.
24451369 these results suggest that the polarized redistribution of VE-PTP in response to shear stress plays an important role in the regulation of endothelial cells function by blood flow.
22275360 zinc(II) ions regulate receptor protein-tyrosine phosphatase beta activity at picomolar concentrations.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20301196 Suggest that VE-PTP, in cooperation with integrins, regulates the spreading and migration of endothelial cells during angiogenesis.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19136612 vascular endothelial protein tyrosine phosphatase contributes to endothelial morphogenesis. Silencing of VE-PTP expression was accompanied by increased VEGF receptor-2 tyrosine phosphorylation and activation of downstream signaling pathways.
More...

AA Sequence

MLSHGAGLALWITLSLLQTGLAEPERCNFTLAESKASSHSVSIQWRILGSPCNFSLIYSSDTLGAALCPT      1 - 70
FRIDNTTYGCNLQDLQAGTIYNFRIISLDEERTVVLQTDPLPPARFGVSKEKTTSTSLHVWWTPSSGKVT     71 - 140
SYEVQLFDENNQKIQGVQIQESTSWNEYTFFNLTAGSKYNIAITAVSGGKRSFSVYTNGSTVPSPVKDIG    141 - 210
ISTKANSLLISWSHGSGNVERYRLMLMDKGILVHGGVVDKHATSYAFHGLTPGYLYNLTVMTEAAGLQNY    211 - 280
RWKLVRTAPMEVSNLKVTNDGSLTSLKVKWQRPPGNVDSYNITLSHKGTIKESRVLAPWITETHFKELVP    281 - 350
GRLYQVTVSCVSGELSAQKMAVGRTFPDKVANLEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVLL    351 - 420
NITVGKEETQYVMDDTGLVPGRQYEVEVIVESGNLKNSERCQGRTVPLAVLQLRVKHANETSLSIMWQTP    421 - 490
VAEWEKYIISLADRDLLLIHKSLSKDAKEFTFTDLVPGRKYMATVTSISGDLKNSSSVKGRTVPAQVTDL    491 - 560
HVANQGMTSSLFTNWTQAQGDVEFYQVLLIHENVVIKNESISSETSRYSFHSLKSGSLYSVVVTTVSGGI    561 - 630
SSRQVVVEGRTVPSSVSGVTVNNSGRNDYLSVSWLLAPGDVDNYEVTLSHDGKVVQSLVIAKSVRECSFS    631 - 700
SLTPGRLYTVTITTRSGKYENHSFSQERTVPDKVQGVSVSNSARSDYLRVSWVHATGDFDHYEVTIKNKN    701 - 770
NFIQTKSIPKSENECVFVQLVPGRLYSVTVTTKSGQYEANEQGNGRTIPEPVKDLTLRNRSTEDLHVTWS    771 - 840
GANGDVDQYEIQLLFNDMKVFPPFHLVNTATEYRFTSLTPGRQYKILVLTISGDVQQSAFIEGFTVPSAV    841 - 910
KNIHISPNGATDSLTVNWTPGGGDVDSYTVSAFRHSQKVDSQTIPKHVFEHTFHRLEAGEQYQIMIASVS    911 - 980
GSLKNQINVVGRTVPASVQGVIADNAYSSYSLIVSWQKAAGVAERYDILLLTENGILLRNTSEPATTKQH    981 - 1050
KFEDLTPGKKYKIQILTVSGGLFSKEAQTEGRTVPAAVTDLRITENSTRHLSFRWTASEGELSWYNIFLY   1051 - 1120
NPDGNLQERAQVDPLVQSFSFQNLLQGRMYKMVIVTHSGELSNESFIFGRTVPASVSHLRGSNRNTTDSL   1121 - 1190
WFNWSPASGDFDFYELILYNPNGTKKENWKDKDLTEWRFQGLVPGRKYVLWVVTHSGDLSNKVTAESRTA   1191 - 1260
PSPPSLMSFADIANTSLAITWKGPPDWTDYNDFELQWLPRDALTVFNPYNNRKSEGRIVYGLRPGRSYQF   1261 - 1330
NVKTVSGDSWKTYSKPIFGSVRTKPDKIQNLHCRPQNSTAIACSWIPPDSDFDGYSIECRKMDTQEVEFS   1331 - 1400
RKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVEDSTITMIDRPPPPPPHIRVNEKDVLISKSSIN   1401 - 1470
FTVNCSWFSDTNGAVKYFTVVVREADGSDELKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAENPNSN   1471 - 1540
SKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPIT   1541 - 1610
TESEPLFGAIEGVSAGLFLIGMLVAVVALLICRQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTS   1611 - 1680
CPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVD   1681 - 1750
DDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQ   1751 - 1820
DSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDY   1821 - 1890
INRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCV   1891 - 1960
RDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH                                    1961 - 1997
//

Text Mined References (47)

PMID Year Title
25180601 2014 Targeting VE-PTP activates TIE2 and stabilizes the ocular vasculature.
24795022 2014 Angiogenesis-related gene mutations drive a subset of angiosarcomas.
24633157 2014 Recurrent PTPRB and PLCG1 mutations in angiosarcoma.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24451369 2014 Shear stress-induced redistribution of vascular endothelial-protein-tyrosine phosphatase (VE-PTP) in endothelial cells and its role in cell elongation.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
22275360 2012 Picomolar concentrations of free zinc(II) ions regulate receptor protein-tyrosine phosphatase ? activity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20301196 2010 Promotion of cell spreading and migration by vascular endothelial-protein tyrosine phosphatase (VE-PTP) in cooperation with integrins.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
More...