Property Summary

NCBI Gene PubMed Count 42
Grant Count 22
R01 Count 17
Funding $1,720,589.79
PubMed Score 106.47
PubTator Score 51.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis 1.091 0.002
osteosarcoma -1.627 0.000
cystic fibrosis 1.623 0.000
medulloblastoma, large-cell -1.500 0.002
adrenocortical carcinoma -2.186 0.000
pancreatic ductal adenocarcinoma liver m... -2.160 0.001
non-small cell lung cancer -3.538 0.000
lung cancer -3.600 0.000
lung adenocarcinoma -2.700 0.000
adult high grade glioma -1.100 0.008
atypical teratoid/rhabdoid tumor -1.100 0.029
acute myeloid leukemia -1.400 0.035
lung carcinoma -2.500 0.000
breast carcinoma -1.100 0.000
Breast cancer 1.300 0.000
ductal carcinoma in situ -1.700 0.000
invasive ductal carcinoma -2.600 0.000

Gene RIF (15)

PMID Text
25180601 VE-PTP activates TIE2 and stabilizes retinal and choroidal blood vessels
24965120 HIV-1 Tat C treated human brain microvascular endothelial cells result in downregulation and dissociation of VE-PTP and SHP2 from VE-cadherin
24795022 Results provide evidence that PTPRB and PLCG1 mutations are driving events in a subset of secondary angiosarcomas.
24633157 The endothelial phosphatase PTPRB, a negative regulator of vascular growth factor tyrosine kinases, harbored predominantly truncating mutations in 10 of 39 angiosarcoma tumors.
24451369 these results suggest that the polarized redistribution of VE-PTP in response to shear stress plays an important role in the regulation of endothelial cells function by blood flow.
22275360 zinc(II) ions regulate receptor protein-tyrosine phosphatase beta activity at picomolar concentrations.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20301196 Suggest that VE-PTP, in cooperation with integrins, regulates the spreading and migration of endothelial cells during angiogenesis.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19136612 vascular endothelial protein tyrosine phosphatase contributes to endothelial morphogenesis. Silencing of VE-PTP expression was accompanied by increased VEGF receptor-2 tyrosine phosphorylation and activation of downstream signaling pathways.
More...

AA Sequence

MLSHGAGLALWITLSLLQTGLAEPERCNFTLAESKASSHSVSIQWRILGSPCNFSLIYSSDTLGAALCPT      1 - 70
FRIDNTTYGCNLQDLQAGTIYNFRIISLDEERTVVLQTDPLPPARFGVSKEKTTSTSLHVWWTPSSGKVT     71 - 140
SYEVQLFDENNQKIQGVQIQESTSWNEYTFFNLTAGSKYNIAITAVSGGKRSFSVYTNGSTVPSPVKDIG    141 - 210
ISTKANSLLISWSHGSGNVERYRLMLMDKGILVHGGVVDKHATSYAFHGLTPGYLYNLTVMTEAAGLQNY    211 - 280
RWKLVRTAPMEVSNLKVTNDGSLTSLKVKWQRPPGNVDSYNITLSHKGTIKESRVLAPWITETHFKELVP    281 - 350
GRLYQVTVSCVSGELSAQKMAVGRTFPDKVANLEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVLL    351 - 420
NITVGKEETQYVMDDTGLVPGRQYEVEVIVESGNLKNSERCQGRTVPLAVLQLRVKHANETSLSIMWQTP    421 - 490
VAEWEKYIISLADRDLLLIHKSLSKDAKEFTFTDLVPGRKYMATVTSISGDLKNSSSVKGRTVPAQVTDL    491 - 560
HVANQGMTSSLFTNWTQAQGDVEFYQVLLIHENVVIKNESISSETSRYSFHSLKSGSLYSVVVTTVSGGI    561 - 630
SSRQVVVEGRTVPSSVSGVTVNNSGRNDYLSVSWLLAPGDVDNYEVTLSHDGKVVQSLVIAKSVRECSFS    631 - 700
SLTPGRLYTVTITTRSGKYENHSFSQERTVPDKVQGVSVSNSARSDYLRVSWVHATGDFDHYEVTIKNKN    701 - 770
NFIQTKSIPKSENECVFVQLVPGRLYSVTVTTKSGQYEANEQGNGRTIPEPVKDLTLRNRSTEDLHVTWS    771 - 840
GANGDVDQYEIQLLFNDMKVFPPFHLVNTATEYRFTSLTPGRQYKILVLTISGDVQQSAFIEGFTVPSAV    841 - 910
KNIHISPNGATDSLTVNWTPGGGDVDSYTVSAFRHSQKVDSQTIPKHVFEHTFHRLEAGEQYQIMIASVS    911 - 980
GSLKNQINVVGRTVPASVQGVIADNAYSSYSLIVSWQKAAGVAERYDILLLTENGILLRNTSEPATTKQH    981 - 1050
KFEDLTPGKKYKIQILTVSGGLFSKEAQTEGRTVPAAVTDLRITENSTRHLSFRWTASEGELSWYNIFLY   1051 - 1120
NPDGNLQERAQVDPLVQSFSFQNLLQGRMYKMVIVTHSGELSNESFIFGRTVPASVSHLRGSNRNTTDSL   1121 - 1190
WFNWSPASGDFDFYELILYNPNGTKKENWKDKDLTEWRFQGLVPGRKYVLWVVTHSGDLSNKVTAESRTA   1191 - 1260
PSPPSLMSFADIANTSLAITWKGPPDWTDYNDFELQWLPRDALTVFNPYNNRKSEGRIVYGLRPGRSYQF   1261 - 1330
NVKTVSGDSWKTYSKPIFGSVRTKPDKIQNLHCRPQNSTAIACSWIPPDSDFDGYSIECRKMDTQEVEFS   1331 - 1400
RKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVEDSTITMIDRPPPPPPHIRVNEKDVLISKSSIN   1401 - 1470
FTVNCSWFSDTNGAVKYFTVVVREADGSDELKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAENPNSN   1471 - 1540
SKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPIT   1541 - 1610
TESEPLFGAIEGVSAGLFLIGMLVAVVALLICRQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTS   1611 - 1680
CPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVD   1681 - 1750
DDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQ   1751 - 1820
DSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDY   1821 - 1890
INRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCV   1891 - 1960
RDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH                                    1961 - 1997
//

Text Mined References (47)

PMID Year Title
25180601 2014 Targeting VE-PTP activates TIE2 and stabilizes the ocular vasculature.
24795022 2014 Angiogenesis-related gene mutations drive a subset of angiosarcomas.
24633157 2014 Recurrent PTPRB and PLCG1 mutations in angiosarcoma.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24451369 2014 Shear stress-induced redistribution of vascular endothelial-protein-tyrosine phosphatase (VE-PTP) in endothelial cells and its role in cell elongation.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
22275360 2012 Picomolar concentrations of free zinc(II) ions regulate receptor protein-tyrosine phosphatase ? activity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20301196 2010 Promotion of cell spreading and migration by vascular endothelial-protein tyrosine phosphatase (VE-PTP) in cooperation with integrins.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
More...