Property Summary

NCBI Gene PubMed Count 214
Grant Count 168
R01 Count 102
Funding $10,249,898.1
PubMed Score 446.57
PubTator Score 368.60

Knowledge Summary

Patent (42,110)

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 3.300 0.000
pancreatic cancer -1.200 0.043
Multiple myeloma 1.792 0.004
malignant mesothelioma -1.200 0.000
ependymoma 1.100 0.020
osteosarcoma 2.061 0.000
astrocytoma 1.400 0.005
atypical teratoid / rhabdoid tumor 1.300 0.013
medulloblastoma, large-cell -1.300 0.000
lung cancer -1.800 0.002
group 4 medulloblastoma 1.300 0.030
pancreatic carcinoma -1.200 0.043
ovarian cancer -2.400 0.000
pituitary cancer -1.100 0.039
dermatomyositis 1.100 0.002

Synonym

Accession P23458 Q59GQ2 Q9UD26
Symbols JTK3
JAK1A
JAK1B

Gene

PDB

5IXI   5IXD   3EYG   3EYH   4E4L   4E4N   4E5W   4EHZ   4EI4   4FK6   4GS0   4I5C   4IVB   4IVC   4IVD   4K6Z   4K77   4L00   4L01   5E1E   5HX8  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (154)

PMID Text
26783077 When association tests were applied to data from the Diabetes Heart Study, it found exome variants of POMGNT1 and JAK1 genes were associated with type 2 diabetes.
26586478 Data suggest that targeting both TGF-beta and Janus kinase 1 (JAK1) signaling could be explored therapeutically in pancreatic ductal adenocarcinomas (PDACs) patients whose cancers exhibit an angiogenesis gene signature.
26396258 Data show that JAK/STAT signaling inhibition is potentiated by Bcl-xL (B-cell lymphoma-extra large) blockade in interleukin 2 (IL-2) dependent adult T-cell leukemia cells.
26238487 Data indicate direct effects of sorafenib on the Janus kinase JAK1-transcription factors STAT3/5 signaling pathway in immune cells.
26215634 Increased expression of SgK223 occurs in PDAC, and overexpression of SgK223 in pancreatic ductal epithelial cells promotes acquisition of a migratory and invasive phenotype through enhanced JAK1/Stat3 signaling
26193702 Data show that IFN-lambda induced a faster but shorter expression of suppressor of cytokine signaling 1 (SOCS1) which inhibited Janus kinase/signal transducer and activator of transcription (Jak/STAT) pathway and phosphorylation.
26188635 Mutations leading to constitutive active gp130/JAK1/STAT3 pathway.
26130650 Expression analysis revealed upregulation of IL6 and CD126 and GP130 in ALDH(hi) endometrial cancer ... targeted inhibition of the IL6 receptor and its downstream effectors JAK1 and STAT3 reduced tumor cell growth.
26119280 Shp-2 contributes to the control of respiratory syncytial virus replication and progeny production in pulmonary alveolar epithelial cells by interfering with IFN-alpha-induced Jak/Stat1 pathway activation
26005883 Genetic variants of the genes JAK1 and the TNFAIP3 were not associated with Behcet's disease in a Spanish population.
More...

AA Sequence

MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRI      1 - 70
SPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEK     71 - 140
KKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPE    141 - 210
LPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKH    211 - 280
YGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKH    281 - 350
KKDEEKNKIREEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH    351 - 420
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQG    421 - 490
AQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVATKK    491 - 560
AQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRD    561 - 630
ISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLAS    631 - 700
ALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNL    701 - 770
SVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA    771 - 840
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSL    841 - 910
KPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQ    911 - 980
LKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAP    981 - 1050
ECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNC   1051 - 1120
PDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK                                       1121 - 1154
//

Text Mined References (220)

PMID Year Title
26783077 2016 Generalization of Rare Variant Association Tests for Longitudinal Family Studies.
26586478 2016 Angiogenic gene signature in human pancreatic cancer correlates with TGF-beta and inflammatory transcriptomes.
26396258 2015 Selective targeting of JAK/STAT signaling is potentiated by Bcl-xL blockade in IL-2-dependent adult T-cell leukemia.
26238487 2015 The Raf Kinase Inhibitor Sorafenib Inhibits JAK-STAT Signal Transduction in Human Immune Cells.
26215634 2015 The pseudokinase SgK223 promotes invasion of pancreatic ductal epithelial cells through JAK1/Stat3 signaling.
26193702 2015 Type III Interferon Induces Distinct SOCS1 Expression Pattern that Contributes to Delayed but Prolonged Activation of Jak/STAT Signaling Pathway: Implications for Treatment Non-Response in HCV Patients.
26188635 2015 Mutations leading to constitutive active gp130/JAK1/STAT3 pathway.
26130650 2015 IL6/JAK1/STAT3 Signaling Blockade in Endometrial Cancer Affects the ALDHhi/CD126+ Stem-like Component and Reduces Tumor Burden.
26119280 2015 Shp-2 contributes to anti-RSV activity in human pulmonary alveolar epithelial cells by interfering with the IFN-?-induced Jak/Stat1 pathway.
26005883 Lack of association of TNFAIP3 and JAK1 with Behçet's disease in the European population.
More...