Property Summary

NCBI Gene PubMed Count 248
Grant Count 579
R01 Count 376
Funding $42,318,703.96
PubMed Score 0.00
PubTator Score 796.60

Knowledge Summary

Patent (50,455)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.400 0.001
osteosarcoma 1.189 0.000
group 3 medulloblastoma 1.100 0.002
Pick disease -1.100 0.009
progressive supranuclear palsy -1.100 0.038
ovarian cancer -1.500 0.000

Synonym

Accession P23443 B2R779 B4DLT4 B4DTG1 E7ESB8 F6UYM1 Q7Z721 S6K-beta-1
Symbols S6K
PS6K
S6K1
STK14A
p70-S6K
p70 S6KA
p70-alpha
S6K-beta-1
p70(S6K)-alpha

Gene

PDB

3A60   3A61   3A62   3WE4   3WF5   3WF6   3WF7   3WF8   3WF9   4L3J   4L3L   4L42   4L43   4L44   4L45   4L46   4RLO   4RLP  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (201)

PMID Text
26818518 This study report that protein levels of the p70 S6 kinase was increased in Progressive Supranuclear Palsy and Corticobasal Degeneration brains.
26626074 Our results suggest that silencing of AT1R inhibits EMT induced by HG in HK-2 cells via inactivation of mTOR/p70S6K signaling pathway.
26514620 Collectively, our findings suggested that both in vitro and in vivo differentiation of Th17 cells were positively regulated by p70(S6K1)
26506538 Our study indicated that Microcystin-LR exposure promoted HL7702 cell proliferation and the main mechanism was the activation of Akt/S6K1 cascade.
26468204 These data suggest that S6K1 may represent a molecular link between aging and Alzheimer disease.
26427479 Results suggest that blocking both the mTOR kinase downstream targets 4E-BP1 protein and p70 S6 kinase 1, but not p70 S6 kinase 1 alone, prevents the migration of retinal pigment epithelium (RPE) cells.
26362858 These results indicate that the inhibitory effect of rapamycin may be due mainly to increased p14, p15, and p57 expression via promoter demethylation and decreased mTOR and p70S6K expression in ALL cell lines.
26238185 MiR-497 decreases cisplatin resistance in ovarian cancer cells by targeting mTOR/P70S6K1.
26235873 Inactivated Sendai virus induces apoptosis and autophagy via the PI3K/Akt/mTOR/p70S6K pathway in human non-small cell lung cancer cells.
26172298 eIF3 has a role in controlling cell size independently of S6K1-activity
More...

AA Sequence

MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCE      1 - 70
KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHT     71 - 140
KAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLH    141 - 210
QKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLG    211 - 280
ALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHP    281 - 350
FFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE    351 - 420
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSG    421 - 490
EASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL                                       491 - 525
//

Text Mined References (263)

PMID Year Title
26818518 2016 Rho Kinase Inhibition as a Therapeutic for Progressive Supranuclear Palsy and Corticobasal Degeneration.
26626074 2016 Silencing of angiotensin II type-1 receptor inhibits high glucose-induced epithelial-mesenchymal transition in human renal proximal tubular epithelial cells via inactivation of mTOR/p70S6K signaling pathway.
26514620 2016 p(??S?K¹) in the TORC1 pathway is essential for the differentiation of Th17 Cells, but not Th1, Th2, or Treg cells in mice.
26506538 2016 Microcystin-LR promotes proliferation by activating Akt/S6K1 pathway and disordering apoptosis and cell cycle associated proteins phosphorylation in HL7702 cells.
26496226 2015 Immediate-early response 5 (IER5) interacts with protein phosphatase 2A and regulates the phosphorylation of ribosomal protein S6 kinase and heat shock factor 1.
26468204 2015 Reducing Ribosomal Protein S6 Kinase 1 Expression Improves Spatial Memory and Synaptic Plasticity in a Mouse Model of Alzheimer's Disease.
26427479 2016 The mTOR Kinase Inhibitor INK128 Blunts Migration of Cultured Retinal Pigment Epithelial Cells.
26362858 2015 Rapamycin restores p14, p15 and p57 expression and inhibits the mTOR/p70S6K pathway in acute lymphoblastic leukemia cells.
26238185 2015 MiR-497 decreases cisplatin resistance in ovarian cancer cells by targeting mTOR/P70S6K1.
26235873 2015 Inactivated Sendai virus induces apoptosis and autophagy via the PI3K/Akt/mTOR/p70S6K pathway in human non-small cell lung cancer cells.
More...