Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $334,460.4
PubMed Score 53.36
PubTator Score 13.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group A ependymoma -1.900 0.000
glioblastoma -1.200 0.039
medulloblastoma 2.100 0.012
subependymal giant cell astrocytoma -5.405 0.001
psoriasis -2.100 0.000

Gene RIF (2)

PMID Text
22117778 Cbln1 and Cbln2 are co-expressed in the endolysosomal compartment of the thalamic neurons responsible for the synaptic alterations in striatum of Cbln1-null mice.
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLGVLELLLLGAAWLAGPARGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRST      1 - 70
NHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVIS     71 - 140
AFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL                     141 - 193
//

Text Mined References (12)

PMID Year Title
24133439 2013 Genome-wide association study of autistic-like traits in a general population study of young adults.
22117778 2012 Comparison of Cbln1 and Cbln2 functions using transgenic and knockout mice.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10688962 2000 Cerebellin stimulates the secretory activity of the rat adrenal gland: in vitro and in vivo studies.
10022429 1999 Cerebellin enhances in vitro secretory activity of human adrenal gland.
7877445 1994 Genomic structure and mapping of precerebellin and a precerebellin-related gene.
More...