Property Summary

NCBI Gene PubMed Count 12
PubMed Score 55.80
PubTator Score 13.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.7e-39
ependymoma 4679 1.2e-05
subependymal giant cell astrocytoma 2287 6.6e-04
glioblastoma 5792 3.9e-02
medulloblastoma 720 4.5e-02
Disease Target Count Z-score Confidence
Benign paroxysmal positional nystagmus 11 3.734 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.800 1.2e-05
glioblastoma -1.200 3.9e-02
medulloblastoma 1.300 4.5e-02
psoriasis -2.100 9.7e-39
subependymal giant cell astrocytoma -5.405 6.6e-04

Gene RIF (2)

AA Sequence

MLGVLELLLLGAAWLAGPARGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRST      1 - 70
NHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVIS     71 - 140
AFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL                     141 - 193
//

Text Mined References (13)

PMID Year Title