Property Summary

NCBI Gene PubMed Count 18
PubMed Score 37.25
PubTator Score 25.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P23434 Q9H1E9
Symbols GCE
NKH

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (6)

AA Sequence

MALRVVRSVRALLCTLRAVPSPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVG      1 - 70
ISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYE     71 - 140
DGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE                                         141 - 173
//

Text Mined References (21)

PMID Year Title