Property Summary

NCBI Gene PubMed Count 17
Grant Count 23
R01 Count 19
Funding $1,764,934.96
PubMed Score 106.86
PubTator Score 48.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.441 0.000
diabetes mellitus -1.100 0.015

Gene RIF (3)

PMID Text
19453261 Observational study of gene-disease association. (HuGE Navigator)
16614355 Myogenin and myogenic differentiation factor D (MyoD) mRNAs increased (P < 0.05) in young and old, whereas myogenic factor (myf)-5 mRNA increased in young only (P < 0.05). Myf-6 protein increased (P < 0.05) in both young and old.
12105204 The myogenic basic helix-loop-helix family of transcription factors, MyoD, Myf5, myogenin, and MRF4, can each activate the muscle differentiation program.

AA Sequence

MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQP      1 - 70
PHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISY     71 - 140
IERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDS    141 - 210
SASSSLRCLSSIVDSISSEERKLPCVEEVVEK                                          211 - 242
//

Text Mined References (18)

PMID Year Title
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
16614355 2006 Efficacy of 3 days/wk resistance training on myofiber hypertrophy and myogenic mechanisms in young vs. older adults.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12105204 2002 The myogenic basic helix-loop-helix family of transcription factors shows similar requirements for SWI/SNF chromatin remodeling enzymes during muscle differentiation in culture.
11368338 2001 Posttranscriptional regulation of human ADH5/FDH and Myf6 gene expression by upstream AUG codons.
11053684 2000 Heterozygous myogenic factor 6 mutation associated with myopathy and severe course of Becker muscular dystrophy.
More...