Property Summary

NCBI Gene PubMed Count 17
PubMed Score 111.33
PubTator Score 48.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.441 2.4e-05
diabetes mellitus -1.100 1.5e-02

Gene RIF (3)

AA Sequence

MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQP      1 - 70
PHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISY     71 - 140
IERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDS    141 - 210
SASSSLRCLSSIVDSISSEERKLPCVEEVVEK                                          211 - 242
//

Text Mined References (18)

PMID Year Title