Property Summary

NCBI Gene PubMed Count 80
Grant Count 52
R01 Count 13
Funding $5,843,939.12
PubMed Score 152.56
PubTator Score 142.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.105 0.011
Multiple myeloma 1.268 0.001
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.600 0.000
lung cancer -2.700 0.044
diabetes mellitus -1.400 0.002
sonic hedgehog group medulloblastoma 1.400 0.000
Pick disease 1.100 0.000

Gene RIF (34)

PMID Text
26526615 a novel cell fate determination mechanism to ensure cells undergo programed cell death through interfering with RPS3/NF-kappaB-conferred anti-apoptotic transcription by the fragment from partial p65 cleavage by activated Caspase-3
26362536 HIV-1 Gag interacts with RPS3 as demonstrated by proximity dependent biotinylation proteomics
26336993 Data show that ribosomal protein S3 (RPS3) knockdown decreased mitochondrial calcium uptake 1 protein (MICU1) expression.
25449781 Increased RPS3 expression is associated with osteosarcoma invasion.
24457201 IkappaBalpha sequesters not only p65 but also RPS3 in the cytoplasm.
24239944 RPS3, a component of basic translation machinery operates at initiation and most probably elongation of protein synthesis, is also implicated in various events of the cell life as an extraribosomal player. [Review]
24211576 These findings suggest that the secreted rpS3 protein is an indicator of malignant tumors.
23911537 rpS3 accumulates in the mitochondria to repair damaged DNA due to the decreased interaction between rpS3 and HSP90 in the cytosol.
23188828 A novel radioresistance mechanism through functional orchestration of rpS3, TRAF2, and NF-kappaB in non-small cell lung cancer cells, is reported.
23131551 rpS3 acts as a microtubule associated protein and regulates spindle dynamics during mitosis.
More...

AA Sequence

MAVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELT      1 - 70
AVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSG     71 - 140
KLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSI    141 - 210
VEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA                                         211 - 243
//

Text Mined References (101)

PMID Year Title
26526615 2015 Caspase-3 cleaved p65 fragment dampens NF-?B-mediated anti-apoptotic transcription by interfering with the p65/RPS3 interaction.
26336993 2015 RPS3 regulates melanoma cell growth and apoptosis by targeting Cyto C/Ca2+/MICU1 dependent mitochondrial signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25449781 2015 Ribosomal protein S3 regulates GLI2-mediated osteosarcoma invasion.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24457201 2014 Ribosomal protein S3 interacts with the NF-?B inhibitor I?B?.
24423872 2014 AUF1 contributes to Cryptochrome1 mRNA degradation and rhythmic translation.
More...