Property Summary

NCBI Gene PubMed Count 31
Grant Count 12
Funding $1,381,526.67
PubMed Score 53.73
PubTator Score 52.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
pancreatic cancer 1.500 0.034
oligodendroglioma 1.200 0.013
psoriasis -2.600 0.000
glioblastoma 1.300 0.000
group 3 medulloblastoma -2.700 0.000
pancreatic ductal adenocarcinoma liver m... -2.603 0.008
lung cancer 1.900 0.011
pediatric high grade glioma 1.200 0.003
pilocytic astrocytoma 1.800 0.000
pancreatic carcinoma 1.500 0.034
ovarian cancer 2.600 0.000
Breast cancer 1.400 0.001
pituitary cancer -1.400 0.001

Gene RIF (15)

PMID Text
25231368 Data indicate no mutation was found in glycine cleavage system protein-H (GCSH) and suggest that mutations in both glycine decarboxylase (GLDC) and aminomethyltransferase (AMT) are the main cause of glycine encephalopathy in Malaysian population.
23349517 study reports a novel mutation, c.2296G>T (p.Gly766Cys), in exon 19 of the glycine decarboxylase (GLDC) gene in a consanguineous Indian couple with a history of 4 neonatal deaths
22225612 Study shows that glycine metabolism and the metabolic enzyme glycine decarboxylase (GLDC) drive tumor-initiating cells and tumorigenesis in non-small cell lung cancer.
22171071 Identification of a splice acceptor site mutation and five different non-synonymous variants in GLDC were found in patients with neural tube defects.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18581728 a histidine-to-aspartic acid change at amino acid position 371 (p. His371Asp mutation) in the glycine decarboxylase in a non-ketotic hyperglycemia patient.
17361008 A screening system for GLDC deletions by multiplex ligation-dependent probe amplification identified 14 deletions of different length & Alu-mediated recombination in non-ketotic hyperglycinaemia patients.
16601880 forty different gene alterations in the GLDC gene were identified in patients with glycine encephalopathy
16450403 Observational study of genotype prevalence. (HuGE Navigator)
16404748 the nonketotic hyperglycinemia is due to a novel GLDC mutation.
More...

AA Sequence

MQSCARAWGLRLGRGVGGGRRLAGGSGPCWAPRSRDSSSGGGDSAAAGASRLLERLLPRHDDFARRHIGP      1 - 70
GDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATLHAISSKNQIWRSYIGMGYYN     71 - 140
CSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGTAAAEALQLC    141 - 210
YRHNKRRKFLVDPRCHPQTIAVVQTRAKYTGVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKVEDFTELV    211 - 280
ERAHQSGSLACCATDLLALCILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVG    281 - 350
VTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSE    351 - 420
GLKRAGHQLQHDLFFDTLKIQCGCSVKEVLGRAAQRQINFRLFEDGTLGISLDETVNEKDLDDLLWIFGC    421 - 490
ESSAELVAESMGEECRGIPGSVFKRTSPFLTHQVFNSYHSETNIVRYMKKLENKDISLVHSMIPLGSCTM    491 - 560
KLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIR    561 - 630
AYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYP    631 - 700
STNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPI    701 - 770
GVKKHLAPFLPNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYM    771 - 840
AKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTES    841 - 910
EDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPEN    911 - 980
KFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS                                  981 - 1020
//

Text Mined References (36)

PMID Year Title
25231368 2014 Mutation analysis of glycine decarboxylase, aminomethyltransferase and glycine cleavage system protein-H genes in 13 unrelated families with glycine encephalopathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23349517 2014 A novel glycine decarboxylase gene mutation in an Indian family with nonketotic hyperglycinemia.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22225612 2012 Glycine decarboxylase activity drives non-small cell lung cancer tumor-initiating cells and tumorigenesis.
22171071 2012 Mutations in genes encoding the glycine cleavage system predispose to neural tube defects in mice and humans.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18581728 Non-ketotic hyperglycinemia with a novel GLDC mutation in a Taiwanese child.
18088087 2008 Phosphoproteome of resting human platelets.
More...