Property Summary

NCBI Gene PubMed Count 34
PubMed Score 65.66
PubTator Score 52.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 1.800 5.6e-07
Breast cancer 1.400 5.4e-04
glioblastoma 1.300 1.9e-04
group 3 medulloblastoma -2.700 1.0e-05
lung cancer 1.900 1.1e-02
oligodendroglioma 1.200 1.3e-02
ovarian cancer 2.600 9.6e-05
pancreatic cancer 1.500 3.4e-02
pancreatic carcinoma 1.500 3.4e-02
pancreatic ductal adenocarcinoma liver m... -2.603 7.6e-03
pediatric high grade glioma 1.200 2.8e-03
pituitary cancer -1.400 9.3e-04
psoriasis -1.700 4.4e-03

Synonym

Accession P23378 Q2M2F8
Symbols GCE
GCSP
HYGN1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (17)

AA Sequence

MQSCARAWGLRLGRGVGGGRRLAGGSGPCWAPRSRDSSSGGGDSAAAGASRLLERLLPRHDDFARRHIGP      1 - 70
GDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATLHAISSKNQIWRSYIGMGYYN     71 - 140
CSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGTAAAEALQLC    141 - 210
YRHNKRRKFLVDPRCHPQTIAVVQTRAKYTGVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKVEDFTELV    211 - 280
ERAHQSGSLACCATDLLALCILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVG    281 - 350
VTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSE    351 - 420
GLKRAGHQLQHDLFFDTLKIQCGCSVKEVLGRAAQRQINFRLFEDGTLGISLDETVNEKDLDDLLWIFGC    421 - 490
ESSAELVAESMGEECRGIPGSVFKRTSPFLTHQVFNSYHSETNIVRYMKKLENKDISLVHSMIPLGSCTM    491 - 560
KLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIR    561 - 630
AYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYP    631 - 700
STNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPI    701 - 770
GVKKHLAPFLPNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYM    771 - 840
AKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTES    841 - 910
EDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPEN    911 - 980
KFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS                                  981 - 1020
//

Text Mined References (40)

PMID Year Title