Property Summary

NCBI Gene PubMed Count 33
Grant Count 40
R01 Count 26
Funding $5,643,186.73
PubMed Score 82.65
PubTator Score 266.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.107 0.020
Multiple myeloma 1.295 0.006
osteosarcoma 1.253 0.009
sonic hedgehog group medulloblastoma 1.400 0.002
glioblastoma 1.300 0.028
atypical teratoid/rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.400 0.000
Breast cancer 2.800 0.026
primary Sjogren syndrome 1.400 0.000
aldosterone-producing adenoma -1.081 0.043
ovarian cancer -1.800 0.000

Gene RIF (13)

PMID Text
25202825 ME2 might be an important factor in melanoma progression and a novel biomarker of invasion.
24957098 Data indicate that malic enzyme 2 knockdown impacts phosphatidylinositol 3-kinases/proto-oncogene protein akt (PI3K/AKT) signaling.
23756480 Three SNP alleles in BRD2, Cx-36, and ME2 and microdeletions in 15q13.3, 15q11.2, and 16p13.11 also contribute risk to juvenile myclonic epilepsy.
23334421 p53 represses the expression of the tricarboxylic-acid-cycle-associated malic enzymes ME1 and ME2 in human and mouse cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20824065 Depletion of malic enzyme 2 induced erythroid differentiation in human erythroleukemia cells.
19691144 ME2 activity in Islets of Langerhans cells was measured by a spectrophotometric enzyme assay by utilizing the distinct kinetic properties.
19066393 Single nucleotide polymorphism in ME2 gene is associated with acute lymphoblastic leukemia.
17638511 Schizophrenic subjects are identified with mitochondrial genes involved in oxidative metabolism as showing consistently decreased expression, including ME2.
17418816 These findings provide a molecular rationale for the role of hS14 in TR-dependent transcriptional activation of the expression of specific genes.
More...

AA Sequence

MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHR      1 - 70
NLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDR     71 - 140
GHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNI    141 - 210
ALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDI    211 - 280
QGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLL    281 - 350
VKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALS    351 - 420
NPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSV    421 - 490
FLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRS    491 - 560
EYDSLLPDVYEWPESASSPPVITE                                                  561 - 584
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25202825 2015 Human mitochondrial NAD(P)(+)-dependent malic enzyme participates in cutaneous melanoma progression and invasion.
24957098 2014 Knockdown of malic enzyme 2 suppresses lung tumor growth, induces differentiation and impacts PI3K/AKT signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23756480 2013 The quest for juvenile myoclonic epilepsy genes.
23334421 2013 Reciprocal regulation of p53 and malic enzymes modulates metabolism and senescence.
21269460 2011 Initial characterization of the human central proteome.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20824065 2010 Induction of erythroid differentiation in human erythroleukemia cells by depletion of malic enzyme 2.
More...