Property Summary

NCBI Gene PubMed Count 37
PubMed Score 84.55
PubTator Score 266.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
aldosterone-producing adenoma -1.081 4.3e-02
atypical teratoid / rhabdoid tumor 1.300 1.5e-03
Breast cancer 2.800 2.6e-02
glioblastoma 1.300 2.8e-02
group 4 medulloblastoma 1.100 1.4e-02
medulloblastoma, large-cell 1.400 2.7e-04
Multiple myeloma 1.295 5.6e-03
osteosarcoma 1.253 9.0e-03
ovarian cancer -1.800 2.7e-07
primary Sjogren syndrome 1.400 1.9e-04
Waldenstrons macroglobulinemia 1.107 2.0e-02

Gene RIF (17)

AA Sequence

MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHR      1 - 70
NLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDR     71 - 140
GHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNI    141 - 210
ALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDI    211 - 280
QGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLL    281 - 350
VKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALS    351 - 420
NPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSV    421 - 490
FLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRS    491 - 560
EYDSLLPDVYEWPESASSPPVITE                                                  561 - 584
//

Text Mined References (44)

PMID Year Title