Property Summary

NCBI Gene PubMed Count 72
PubMed Score 424.57
PubTator Score 224.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Kallmann syndrome 33 0.0 4.0
Disease Target Count
Cryptorchidism 296
Abnormality of body height 13
Abnormality of the voice 46
Absence of pubertal development 17
Absence of secondary sex characteristics 22
Anosmia 22
Anterior hypopituitarism 18
Anxiety 136
Anxiety disease 113
Atrophy of testis 14
Byzanthine arch palate 194
Cerebellar Ataxia 304
Congenital hypoplasia of breast 25
Congenital hypoplasia of ovary 30
Congenital hypoplasia of penis 176
Congenital pes cavus 88
Decreased bone mineral density Z score 31
Decreased circulating follicle stimulating hormone level 1
Decreased circulating luteinizing hormone level 1
Decreased fertility 33
Decreased testosterone in males 28
Delayed Puberty 97
Delayed bone age 136
Depressive disorder 409
Erectile abnormalities 16
Erectile dysfunction 32
Eunuchoid habitus 14
Female hypogonadism syndrome 25
Generalized osteopenia 99
Gynecomastia 64
Hypogonadism, Isolated Hypogonadotropic 71
Hypoplastic ovary 30
Hypothalamic gonadotropin-releasing hormone deficiency 14
Impaired FSH and LH secretion 1
Increased female libido 13
Infantile uterus 23
Kallmann Syndrome 1 1
Kallmann Syndrome 2 (disorder) 18
Leydig cell insensitivity to gonadotropin 1
Mirror movements disorder 8
Non-obstructive azoospermia 21
Olfactory lobe absence 6
Osteopenia 99
Osteoporosis 363
Primary physiologic amenorrhea 55
Secondary physiologic amenorrhea 32
Sense of smell impaired 21
Small testicle 75
Sparse body hair 32
Sparse pubic hair 31
Testicular hypogonadism 21
Unilateral agenesis of kidney 20
Wide spaced nipples 46
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.100 2.9e-08
chronic rhinosinusitis -1.585 7.4e-03
colon cancer 2.300 1.7e-02
cystic fibrosis 1.228 7.9e-05
group 4 medulloblastoma -1.800 2.8e-03
interstitial cystitis 1.600 8.1e-05
intraductal papillary-mucinous adenoma (... 1.700 2.4e-02
limb girdle muscular dystrophy 2B -1.181 4.5e-05
lung adenocarcinoma -2.200 1.7e-14
lung cancer -3.400 6.9e-07
lung carcinoma -2.500 1.0e-16
medulloblastoma, large-cell -3.400 8.0e-05
non-small cell lung cancer -2.595 5.2e-21
ovarian cancer -4.000 8.7e-10
pancreatic cancer 1.100 3.1e-03
pituitary cancer 2.100 1.4e-02
progressive supranuclear palsy -1.500 9.8e-03

Gene RIF (50)

AA Sequence

MVPGVPGAVLTLCLWLAASSGCLAAGPGAAAARRLDESLSAGSVQRARCASRCLSLQITRISAFFQHFQN      1 - 70
NGSLVWCQNHKQCSKCLEPCKESGDLRKHQCQSFCEPLFPKKSYECLTSCEFLKYILLVKQGDCPAPEKA     71 - 140
SGFAAACVESCEVDNECSGVKKCCSNGCGHTCQVPKTLYKGVPLKPRKELRFTELQSGQLEVKWSSKFNI    141 - 210
SIEPVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKH    211 - 280
FRSSKDPSAPPAPANLRLANSTVNSDGSVTVTIVWDLPEEPDIPVHHYKVFWSWMVSSKSLVPTKKKRRK    281 - 350
TTDGFQNSVILEKLQPDCDYVVELQAITYWGQTRLKSAKVSLHFTSTHATNNKEQLVKTRKGGIQTQLPF    351 - 420
QRRRPTRPLEVGAPFYQDGQLQVKVYWKKTEDPTVNRYHVRWFPEACAHNRTTGSEASSGMTHENYIILQ    421 - 490
DLSFSCKYKVTVQPIRPKSHSKAEAVFFTTPPCSALKGKSHKPVGCLGEAGHVLSKVLAKPENLSASFIV    491 - 560
QDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPSTLY    561 - 630
RLEVQVLTPGGEGPATIKTFRTPELPPSSAHRSHLKHRHPHHYKPSPERY                        631 - 680
//

Text Mined References (78)

PMID Year Title