Property Summary

NCBI Gene PubMed Count 90
PubMed Score 281.87
PubTator Score 928.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Vasospasm, Intracranial 5
Disease Target Count P-value
oligodendroglioma 2849 7.04817917826964E-9
ependymoma 2514 2.08204997038495E-7
ovarian cancer 8492 1.15950032926873E-6
juvenile dermatomyositis 1189 1.71128109766367E-6
primitive neuroectodermal tumor 3031 3.24799258377052E-5
dermatomyositis 967 8.90653250742309E-5
medulloblastoma, large-cell 6234 8.99285857970622E-5
group 3 medulloblastoma 2254 2.50684348364782E-4
atypical teratoid/rhabdoid tumor 1095 5.92950135206846E-4
psoriasis 6685 9.3801500182303E-4
pediatric high grade glioma 2712 9.63282846455125E-4
glioblastoma 5572 0.0117934362864626

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.800 0.000
psoriasis -1.400 0.001
oligodendroglioma -1.100 0.000
glioblastoma -2.200 0.012
group 3 medulloblastoma -2.900 0.000
atypical teratoid/rhabdoid tumor -1.900 0.001
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -2.100 0.000
juvenile dermatomyositis -1.113 0.000
pediatric high grade glioma -1.600 0.001
ovarian cancer 1.200 0.000
dermatomyositis -2.300 0.000

Synonym

Accession P23297 B2R5D9 Q5T7Y3
Symbols S100
S100A
S100-alpha

Gene

PDB

2L0P   2LHL   2LLS   2LLT   2LLU   2LP2   2LP3   2LUX   2M3W  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

Gene RIF (55)

PMID Text
25611268 The relationship between the degree of infiltration by S100-positive (S100+) dendritic cells and prognostic factors, including histological subtype, histological grade, peritumor inflammatory infiltration, and stromal desmoplasia, were examined.
25269953 Data indicate that Cu-oxidized S100 calcium binding protein A4 (S100A4) interacted with S100 calcium binding protein A1 (S100A1) and prevented protein phosphatase 5 (PP5) activation.
25157660 In this review, we aim to describe the molecular basis and regulatory function of S100A1--{REVIEW}
24833748 Patients with acute myocardial infarction (MI) showed significantly increased S100A1 serum levels. S100A1 signaling in cardiac fibroblasts occurs through endosomal TLR4/MyD88.
24501865 Twenty-seven out of thirty-two (84.38%) cases of serous ovarian carcinoma were found to express S100A1. S100A1 expression was observed in one out of the two mucinous and three out of the six endometroid ovarian carcinomas.
24402969 It was suggested that S100A1 and S100B be used as markers to develop potency assays for cartilage regeneration cell therapies, and as a redifferentiation readout in monolayer cultures aiming to investigate stimuli for chondrogenic induction.
24244340 hypoxia-induced MiR-138 is an essential mediator of EC dysfunction via its ability to target the 3'UTR of S100A1.
23683996 For autopsy material, all human cases of definite myocardial infarction and suspected early infarction showed well-defined areas without S100A1 staining.
23671622 The triple mutation Arg852/Lys859/Arg860 exhibited significant disruption of the binding of S100A1 to TRPC6 implicating their involvement in the binding site.
23662436 In this review we will focus on the roles of S100A proteins in intracellular and extracellular calcium signalling and homeostasis.
More...

AA Sequence

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEV      1 - 70
DFQEYVVLVAALTVACNNFFWENS                                                   71 - 94
//

Text Mined References (95)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25611268 2014 S100-positive dendritic cells in squamous cell laryngeal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25269953 2014 Oxidized S100A4 inhibits the activation of protein phosphatase 5 through S100A1 in MKN?45 gastric carcinoma cells.
25157660 2014 S100A1: a major player in cardiovascular performance.
24833748 2014 S100A1 is released from ischemic cardiomyocytes and signals myocardial damage via Toll-like receptor 4.
24501865 2013 [Evaluation of the expression of S100A1 protein in serous, mucinous and endometroid ovarian carcinoma].
24402969 2014 S100A1 and S100B expression patterns identify differentiation status of human articular chondrocytes.
24244340 2013 MicroRNA-138 regulates hypoxia-induced endothelial cell dysfunction by targeting S100A1.
23683996 2013 Immunohistochemical detection of S100A1 in the postmortem diagnosis of acute myocardial infarction.
More...