Property Summary

NCBI Gene PubMed Count 79
PubMed Score 177.17
PubTator Score 100.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
Duchenne muscular dystrophy 602 1.77903999254902E-10
juvenile dermatomyositis 1189 1.1163660977779E-9
posterior fossa group A ependymoma 1511 6.02980996592479E-8
ovarian cancer 8492 4.3298786193647E-7
limb girdle muscular dystrophy 2I 56 1.097727781493E-6
atypical teratoid/rhabdoid tumor 1095 5.76021015425461E-6
acute quadriplegic myopathy 1157 1.52509990272842E-5
lung adenocarcinoma 2714 2.77324273005177E-5
pilocytic astrocytoma 3086 3.43986019951483E-5
Becker muscular dystrophy 187 3.60114352573641E-5
pediatric high grade glioma 2712 1.09167540082682E-4
glioblastoma 5572 1.98698559176398E-4
Multiple myeloma 1328 4.66456743095899E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00191582439277905
lung cancer 4473 0.00278915032446783
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00446189384527082
astrocytoma 1493 0.00533948296097354
group 3 medulloblastoma 2254 0.0110901824627739
active Crohn's disease 918 0.011559511089328
dermatomyositis 967 0.0318305006357786
Disease Target Count Z-score Confidence
Osteogenesis imperfecta 34 6.133 3.1
Disease Target Count Z-score Confidence
Bruck syndrome 8 3.843 1.9
Disease Target Count
Osteogenesis imperfecta 9 1

Expression

Synonym

Accession P23284 A8K534 Q6IBH5 Q9BVK5 PPIase B
Symbols OI9
CYPB
SCYLP
CYP-S1
HEL-S-39

Gene

PANTHER Protein Class (1)

PDB

1CYN   3ICH   3ICI  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (47)

PMID Text
26774171 Over-expression of CypB enhances HIV infection by increasing nuclear import of viral DNA.
26634552 This study enhances our knowledge about the mutational pattern of the LEPRE1, CRTAP, and PPIB genes. LEPRE1 should be the first gene analyzed in mutation detection studies in patients with recessive OI.
26125731 Cyclophilin B has a high diagnostic value for stomach cancer and its downregulation can effectively inhibit the growth of stomach cancer cells. Thus, cyclophilin B may be a potential therapeutic target for stomach cancer treatment
25505242 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase B (PPIB, cyclophilin B) is identified by yeast two-hybrid screen
24990953 These findings establish cyclophilin C as an ER cyclophilin, demonstrate the novel involvement of cyclophilins B and C in ER redox homeostasis
24713575 The extracellular portion of cyclophilin B probably plays an important role in human diseases associated with acute or chronic inflammation
24583282 Cyclophilin B is a novel MDM2 interacting partner.
24272483 cyclophilin B (CypB) is a prolyl isomerase residing in the endoplasmic reticulum (ER), that provides an essential survival signal in glioblastoma multiforme cells through myc and mutant p53
24270407 Findings demonstrate that CypB prevents hypoxia-induced cell death through modulation of ubiquitin-mediated CHOP protein degradation, suggesting that CypB may have an important role in the tight regulation of CHOP under hypoxia.
24043621 An additional function of the rough endoplasmic reticulum protein complex prolyl 3-hydroxylase 1.cartilage-associated protein.cyclophilin B: the CXXXC motif reveals disulfide isomerase activity in vitro.
More...

AA Sequence

MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVP      1 - 70
KTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSM     71 - 140
ANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKP    141 - 210
FAIAKE                                                                    211 - 216
//

Text Mined References (84)

PMID Year Title
26774171 2016 Cyclophilin B enhances HIV-1 infection.
26634552 2015 Mutational characterization of the P3H1/CRTAP/CypB complex in recessive osteogenesis imperfecta.
26125731 2015 Expression and role of cyclophilin B in stomach cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24990953 2014 Depletion of cyclophilins B and C leads to dysregulation of endoplasmic reticulum redox homeostasis.
24713575 2014 Functional aspects of extracellular cyclophilins.
24583282 2014 A systems wide mass spectrometric based linear motif screen to identify dominant in-vivo interacting proteins for the ubiquitin ligase MDM2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24272483 2014 Cyclophilin B supports Myc and mutant p53-dependent survival of glioblastoma multiforme cells.
More...