Property Summary

Ligand Count 8
NCBI Gene PubMed Count 83
PubMed Score 187.14
PubTator Score 100.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Osteogenesis Imperfecta, Type IX 1 0.0 0.0
Disease Target Count Z-score Confidence
Osteogenesis imperfecta 34 6.173 3.1
Disease Target Count Z-score Confidence
Bruck syndrome 10 3.702 1.9

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.059 1.2e-02
acute quadriplegic myopathy 1.215 2.3e-04
astrocytoma 1.400 5.3e-03
Astrocytoma, Pilocytic 1.100 3.6e-05
atypical teratoid / rhabdoid tumor 1.100 3.5e-06
autosomal dominant Emery-Dreifuss muscul... 1.233 2.3e-03
Becker muscular dystrophy 1.482 8.3e-05
dermatomyositis 1.100 3.2e-02
Duchenne muscular dystrophy 1.764 7.4e-10
ependymoma 1.100 1.9e-08
glioblastoma 1.800 5.8e-04
group 3 medulloblastoma 1.100 5.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 4.5e-03
juvenile dermatomyositis 1.676 3.7e-09
limb girdle muscular dystrophy 2A 1.205 1.3e-06
lung adenocarcinoma 1.161 2.8e-05
lung cancer 1.300 2.8e-03
Multiple myeloma 1.919 1.1e-03
ovarian cancer -1.200 2.3e-03
pediatric high grade glioma 1.200 2.0e-05

Protein-protein Interaction (2)

Gene RIF (51)

AA Sequence

MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVP      1 - 70
KTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSM     71 - 140
ANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKP    141 - 210
FAIAKE                                                                    211 - 216
//

Text Mined References (88)

PMID Year Title