Property Summary

NCBI Gene PubMed Count 36
Grant Count 17
Funding $2,794,074.11
PubMed Score 376.54
PubTator Score 142.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.200 0.000
tuberculosis and treatment for 3 months -1.200 0.009
lung cancer 4.000 0.000
non-inflammatory breast cancer -1.400 0.000

Gene RIF (16)

PMID Text
26377569 dental plaque amount, lactobacilli count, age, and saliva buffer capacity, as well as CA6 (T55M) gene polymorphism, explained total of 87.8% of variations in DMFT scores.
26125798 We also found that the haplotype (ACA) (rs2274328, rs17032907 and rs11576766)of the carbonic anhydrase VI was associated with a low number of decayed, missing, and filled teeth index with an odds ratio (95% confidence interval) of 0.635 (0.440-0.918).
25447475 Study showed that PROP (6-n-propylthiouracil) bitterness was due to TAS2R38 diplotypes, whereas the density of fungiform papillae was more closely associated with gustin genotypes
24534176 SNPs associated with taste perception and taste bud anatomy
24040192 The rs2274333 polymorphism of the gustin gene affects PROP sensitivity.
23652931 results suggest that polymorphisms in the CA6 gene are associated with the concentrations of secreted CA VI.
22366092 The 1.9A crystal structure of the human CA VI catalytic domain reveals a prototypical mammalian CA fold, and a novel dimeric arrangement as compared to previously-reported CA structures.
22198626 The aim of this study was to investigate carbonic anhydrase (CA) VI Exon 2 single nucleotide polymorphism (SNP) and its possible association with salivary parameters in type 2 diabetic patients compared to healthy adults.
21712049 The data of this study showed how the combination of the TAS2R38 and gustin gene genotypes modulate PROP phenotype.
21631296 The polymerase chain reaction followed by restriction fragment length polymorphism assay described here can be used as an alternative to sequencing in bitter taster status research, and could be employed as a survey tool in nutrigenomic studies.
More...

AA Sequence

MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTG      1 - 70
YETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIV     71 - 140
HYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQ    141 - 210
HYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPN    211 - 280
QEYTLGSEFQFYLHKIEEILDYLRRALN                                              281 - 308
//

Text Mined References (41)

PMID Year Title
26377569 2016 Gene-environment Interactions in the Etiology of Dental Caries.
26125798 2015 Genetic polymorphisms in the carbonic anhydrase VI gene and dental caries susceptibility.
25447475 2015 The gustin (CA6) gene polymorphism, rs2274333 (A/G), is associated with fungiform papilla density, whereas PROP bitterness is mostly due to TAS2R38 in an ethnically-mixed population.
24534176 2014 Exploring associations between taste perception, oral anatomy and polymorphisms in the carbonic anhydrase (gustin) gene CA6.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
24040192 2013 The gustin (CA6) gene polymorphism, rs2274333 (A/G), as a mechanistic link between PROP tasting and fungiform taste papilla density and maintenance.
23652931 2013 Effect of genetic polymorphisms in CA6 gene on the expression and catalytic activity of human salivary carbonic anhydrase VI.
22366092 2012 Crystal structure of the secretory isozyme of mammalian carbonic anhydrases CA VI: implications for biological assembly and inhibitor development.
22198626 2012 The investigation of genetic polymorphisms in the carbonic anhydrase VI gene exon 2 and salivary parameters in type 2 diabetic patients and healthy adults.
21712049 2011 Polymorphisms in TAS2R38 and the taste bud trophic factor, gustin gene co-operate in modulating PROP taste phenotype.
More...