Property Summary

Ligand Count 99
NCBI Gene PubMed Count 37
PubMed Score 403.08
PubTator Score 142.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.200 1.1e-02
non-inflammatory breast cancer -1.400 1.2e-04
psoriasis -2.200 2.7e-07
tuberculosis and treatment for 3 months -1.200 8.9e-03

Gene RIF (17)

AA Sequence

MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTG      1 - 70
YETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIV     71 - 140
HYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQ    141 - 210
HYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPN    211 - 280
QEYTLGSEFQFYLHKIEEILDYLRRALN                                              281 - 308
//

Text Mined References (42)

PMID Year Title