Property Summary

NCBI Gene PubMed Count 71
PubMed Score 20.64
PubTator Score 17.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 1.500 6.3e-16
dermatomyositis 1.100 5.6e-03
lung adenocarcinoma 1.385 4.2e-07
non-small cell lung cancer 1.246 3.0e-19
osteosarcoma -1.369 7.5e-03
ovarian cancer 2.100 1.3e-05
psoriasis 2.300 1.3e-04

Gene RIF (32)

AA Sequence

MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE      1 - 70
PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS     71 - 140
IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL    141 - 210
NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ    211 - 280
SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP    281 - 350
WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE    351 - 420
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ                                           421 - 451
//

Text Mined References (75)

PMID Year Title