Property Summary

NCBI Gene PubMed Count 63
Grant Count 1
R01 Count 1
Funding $270,000
PubMed Score 20.54
PubTator Score 17.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.300 0.000
osteosarcoma -1.369 0.008
non-small cell lung cancer 1.246 0.000
lung adenocarcinoma 1.385 0.000
Breast cancer 1.500 0.000
ovarian cancer 2.100 0.000
dermatomyositis 1.100 0.006

Synonym

Accession P23258 Q53X79 Q9BW59
Symbols TUBG
GCP-1
CDCBM4
TUBGCP1

Gene

 Grant Application (1)

PDB

1Z5V   1Z5W   3CB2  

Gene RIF (31)

PMID Text
26556314 While binding to gamma-tubulin may help target APC to the site of microtubule nucleation complexes, additional C-terminal sequences of APC are required to stimulate and stabilize microtubule growth.
25830658 a causative link between altered function of AURKA-HMMR-TPX2-TUBG1 and breast carcinogenesis in BRCA1/2 mutation carriers
25542213 Results show that CUL4A- and CUL4B-mediated polyubiquitination of gamma-tubulin for its degradation.
25031076 In this study, the molecular basis of interaction between two lateral gamma-tubulin units within the gamma-tubulin ring complex were elucidated by making extensive use of molecular mechanics and molecular dynamics techniques.
24620973 Gamma tubulin expression was associated with patients' age, astrocytoma grade, respectability, patient survival and performance. These factors may be important prognostic indicators for patients with astrocytomas.
23966160 Recombinant gamma-tubulin can be phosphorylated by Cdk1-cyclin B or Brsk1 and dephosphorylated by Ppp4c-R2-R3A in vitro.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22818914 Nek9 phosphorylates NEDD1 on Ser377 driving its recruitment and thereby that of gamma-tubulin to the centrosome in mitotic cells.
22806905 Our results reveal for the first time an increased expression of TUBG1 and TUBG2 in lung cancer
21951856 overexpression of Cdk1 or BRCA1 greatly expands the gamma-tubulin coating of microtubules, suggesting that the microtubule-bound gamma-tubulin is involved in DNA damage response.
More...

AA Sequence

MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE      1 - 70
PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS     71 - 140
IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL    141 - 210
NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ    211 - 280
SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP    281 - 350
WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE    351 - 420
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ                                           421 - 451
//

Text Mined References (66)

PMID Year Title
26556314 2016 APC functions at the centrosome to stimulate microtubule growth.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25830658 2015 Assessing associations between the AURKA-HMMR-TPX2-TUBG1 functional module and breast cancer risk in BRCA1/2 mutation carriers.
25542213 2015 Cullin 4A and 4B ubiquitin ligases interact with ?-tubulin and induce its polyubiquitination.
25031076 2014 Molecular insight into ?-? tubulin lateral interactions within the ?-tubulin ring complex (?-TuRC).
24620973 2014 Association of Aurora A and gamma-tubulin expression in astrocytomas and patient survival.
24561039 2014 Rab11 endosomes contribute to mitotic spindle organization and orientation.
23966160 2013 Protein phosphatase 4 is phosphorylated and inactivated by Cdk in response to spindle toxins and interacts with ?-tubulin.
23603762 2013 Mutations in TUBG1, DYNC1H1, KIF5C and KIF2A cause malformations of cortical development and microcephaly.
22818914 2012 Nek9 phosphorylation of NEDD1/GCP-WD contributes to Plk1 control of ?-tubulin recruitment to the mitotic centrosome.
More...