Property Summary

NCBI Gene PubMed Count 241
PubMed Score 180.44
PubTator Score 210.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 3.0
Disease Target Count Z-score Confidence
Junctional epidermolysis bullosa with pyloric atresia 3 0.0 5.0
Disease Target Count Z-score Confidence
Epidermolysis bullosa 21 5.18 2.6
Disease Target Count Z-score Confidence
Cancer 2499 4.233 2.1

Expression

  Differential Expression (22)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 2.3e-03
Barrett's esophagus 1.700 9.2e-03
Breast cancer -1.500 1.7e-05
Common variable immunodeficiency -1.407 4.3e-03
cystic fibrosis 4.377 6.1e-08
dermatomyositis 1.100 4.7e-03
Duchenne muscular dystrophy 1.033 1.9e-05
ependymoma 1.100 8.6e-05
esophageal adenocarcinoma 1.400 4.3e-02
glioblastoma 1.300 5.7e-03
group 4 medulloblastoma -1.100 4.6e-02
intraductal papillary-mucinous carcinoma... 1.100 8.0e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.7e-03
juvenile dermatomyositis 1.155 3.4e-08
lung adenocarcinoma -1.100 5.8e-05
lung cancer 1.200 2.4e-04
lung carcinoma -1.200 1.3e-05
malignant mesothelioma -1.500 6.4e-05
medulloblastoma, large-cell -1.900 5.1e-03
non-small cell lung cancer 1.074 7.6e-04
osteosarcoma 2.203 3.1e-03
tuberculosis 1.100 3.3e-03

Protein-protein Interaction (5)

Gene RIF (169)

AA Sequence

MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAE      1 - 70
ALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQH     71 - 140
VNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGT    141 - 210
YNWKGIVRVEQKNNTFFDMNIFEDGPYEVGGETEHDESLVPVPANSYLGLLFLTSVSYTDPDQFVYKTRP    211 - 280
PREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEG    281 - 350
LASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGRWNNVKPIRLNGTKDSMFGIAV    351 - 420
KNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVA    421 - 490
VGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGT    491 - 560
LEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP    561 - 630
SSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGV    631 - 700
PELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQN    701 - 770
GSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSG    771 - 840
VAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKV    841 - 910
ESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPL    911 - 980
RGLDSKASLILRSRLWNSTFLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYS    981 - 1050
GVPWWIILVAILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQWI   1051 - 1120
TKWNENESYS                                                               1121 - 1130
//

Text Mined References (250)

PMID Year Title