Property Summary

NCBI Gene PubMed Count 223
Grant Count 44
R01 Count 19
Funding $3,356,236.79
PubMed Score 168.82
PubTator Score 210.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (151)

PMID Text
27001172 HIF-dependent regulation of ITGA6 is one mechanism by which sorting for CD49f (+) cells enhances cancer stem cells.
26674523 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer
26381405 integrin alpha6beta4 stimulates invasion by promoting autocrine EGFR signaling through transcriptional up-regulation of key EGFR family members and by facilitating HGF-stimulated EGFR ligand secretion
26350464 syndecans remain anchored to the alpha6beta4 integrin via its cytoplasmic domain, but the activation of cell motility is disrupted
26239765 Schwann cells in the tumor-nerve environment affect tumor cell migration and invasion through regulation of the laminin receptor A6B1 and its variant A6pB1.
26108791 We here identify CD49f and CD34 as markers to permit selection of the stem/progenitor cell-like population from human myometrium
26013602 CD49f is a marker of bone marrow mesenchymal stem cells and is correlated with changes in these stem cells under inflammatory conditions.
25858144 our observations suggest that miR-25 is a key regulator of invasiveness in human prostate cancer through its direct interactions with av- and a6-integrin expression
25825984 Amphiregulin enhances alpha6beta1 integrin expression and cell motility in human chondrosarcoma cells through Ras/Raf/MEK/ERK/AP-1 pathway.
25561492 Integrin alpha6B-beta1 preferentially binds laminin 511 and this ligand-integrin ligation induces the TAZ nuclear localization and transcriptional activity.
More...

AA Sequence

MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAE      1 - 70
ALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQH     71 - 140
VNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGT    141 - 210
YNWKGIVRVEQKNNTFFDMNIFEDGPYEVGGETEHDESLVPVPANSYLGLLFLTSVSYTDPDQFVYKTRP    211 - 280
PREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEG    281 - 350
LASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGRWNNVKPIRLNGTKDSMFGIAV    351 - 420
KNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVA    421 - 490
VGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGT    491 - 560
LEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP    561 - 630
SSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGV    631 - 700
PELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQN    701 - 770
GSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSG    771 - 840
VAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKV    841 - 910
ESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPL    911 - 980
RGLDSKASLILRSRLWNSTFLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYS    981 - 1050
GVPWWIILVAILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQWI   1051 - 1120
TKWNENESYS                                                               1121 - 1130
//

Text Mined References (232)

PMID Year Title
27001172 2016 ITGA6 is directly regulated by hypoxia-inducible factors and enriches for cancer stem cell activity and invasion in metastatic breast cancer models.
26674523 2015 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer: Models for Global and Disease-Free Survival.
26381405 2015 Integrin ?6?4 Promotes Autocrine Epidermal Growth Factor Receptor (EGFR) Signaling to Stimulate Migration and Invasion toward Hepatocyte Growth Factor (HGF).
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26239765 2016 Schwann Cells Increase Prostate and Pancreatic Tumor Cell Invasion Using Laminin Binding A6 Integrin.
26121317 2015 Clinical significance of the integrin ?6?4 in human malignancies.
26108791 2015 CD34 and CD49f Double-Positive and Lineage Marker-Negative Cells Isolated from Human Myometrium Exhibit Stem Cell-Like Properties Involved in Pregnancy-Induced Uterine Remodeling.
26013602 2015 CD49f Acts as an Inflammation Sensor to Regulate Differentiation, Adhesion, and Migration of Human Mesenchymal Stem Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25911094 2015 Odontogenic Ameloblast-associated Protein (ODAM) Mediates Junctional Epithelium Attachment to Teeth via Integrin-ODAM-Rho Guanine Nucleotide Exchange Factor 5 (ARHGEF5)-RhoA Signaling.
More...