Property Summary

NCBI Gene PubMed Count 233
Grant Count 263
R01 Count 131
Funding $28,147,137.06
PubMed Score 1594.95
PubTator Score 766.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (100)

Disease Z-score Confidence
Arthritis 248 4.201 2.1
Urticaria 53 4.087 2.0
Cancer 2,346 3.966 2.0
Coronary artery disease 240 3.783 1.9
Asthma 349 3.599 1.8
Hypertension 287 3.307 1.7
Gastrointestinal system disease 50 3.268 1.6
Common cold 63 3.241 1.6
Cerebrovascular disease 231 3.171 1.6
Pain agnosia 99 3.146 1.6
Angioedema 36 3.112 1.6
Pleurisy 18 3.095 1.5
Actinic keratosis 22
Acute pain 2
Acute postoperative pain 6
Acute tuberculosis 2
Allergic conjunctivitis 25
Ankylosing spondylitis 138
Arthritic Pain 5
Backache 8
Bronchial Hyperreactivity 13
Bursitis 10
Bursitis of shoulder 4
Chronic pain 9
Chronic ulcerative proctitis 7
Chronic ulcerative rectosigmoiditis 4
Diarrhea 155
Drug allergy 36
Duodenal Ulcer due to H. Pylori 7
Dysmenorrhea 19
Esophageal Neoplasms 67
Fever 34
Flushing 5
Gastric ulcer 34
Gaucher disease type 3 76
Gout 93
Headache disorder 20
Heart failure 80
Hyperalgesia 71
Indigestion 5
Influenza-like symptoms 17
Intestinal Polyps 5
Joint pain 8
Juvenile rheumatoid arthritis 104
Kidney Failure, Chronic 45
Mammary Neoplasms 410
Menorrhagia 8
Migraine 79
Muscle pain 3
Myocardial Infarction 126
Nasal discharge 26
Osteoarthritis 96
Osteoarthritis in Patients at High Ulcer... 7 
Osteoarthrosis of the Knee 4
Ovarian Cysts 34
Pain 70
Patent ductus arteriosus 23
Peripheral Neuropathy 303
Post-Op Ocular Inflammation 10
Post-Op Photophobia 4
Postoperative Ocular Pain 5
Prevention of Ocular Surgery-Induced Mio... 2 
Pulmonary tuberculosis 5
Reperfusion Injury 84
Rheumatism 2
Rheumatoid Arthritis 1,160
Rheumatoid Arthritis in Patient at High ... 7 
Severe pain 12
Shoulder Tendonitis 4
Sinus headache 17
Sleep Deprivation 1
Sprains and Strains 6
Synovitis 38
Tendinitis 13
Tenosynovitis 15
Toothache 6
Ulcerative colitis in remission 4
adult high grade glioma 2,148
astrocytoma 1,493
colon cancer 1,475
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
esophageal adenocarcinoma 737
glioblastoma 5,572
group 3 medulloblastoma 2,254
head and neck cancer 270
interstitial cystitis 2,299
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
psoriasis 6,685
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

  Differential Expression (24)

Disease log2 FC p
pancreatic cancer 1.600 0.000
esophageal adenocarcinoma -1.500 0.018
cutaneous lupus erythematosus -2.000 0.014
psoriasis -1.700 0.001
osteosarcoma -3.526 0.000
posterior fossa group A ependymoma 1.800 0.000
glioblastoma 1.600 0.026
cystic fibrosis 1.613 0.000
astrocytoma 1.800 0.016
colon cancer -3.500 0.001
lung cancer -2.300 0.000
interstitial cystitis 1.300 0.026
adult high grade glioma 2.000 0.000
group 3 medulloblastoma -1.200 0.012
pilocytic astrocytoma 1.500 0.000
pancreatic carcinoma 1.600 0.000
subependymal giant cell astrocytoma 1.321 0.028
lung adenocarcinoma -1.200 0.000
invasive ductal carcinoma 1.900 0.000
lung carcinoma -1.300 0.000
ulcerative colitis 1.800 0.000
ovarian cancer 3.300 0.000
Gaucher disease type 3 -1.100 0.035
head and neck cancer -1.300 0.013

Synonym

Accession P23219 A8K1V7 B4DHQ2 B4E2S5 Q15122 Q3HY28 Q3HY29 Q5T7T6 Q5T7T7 Q5T7T8
Symbols COX1
COX3
PHS1
PCOX1
PES-1
PGHS1
PTGHS
PGG/HS
PGHS-1

Gene

PANTHER Protein Class (2)

Gene RIF (225)

PMID Text
27522738 In Indian peptic ulcer hemorrhage patients, those with Cox-1 A842G polymorphisms tended to have less gastric ulcers among those with the A842G/C50T polymorphism.
26870959 PON1, P2Y12 and COX1 polymorphisms were associated with poorer vascular outcomes in patients with extracranial or intracranial stents.
26703471 inverse allosteric regulation likely underlies the ability of PGHS-2 to operate at low AA concentrations, when PGHS-1 is effectively latent.
26672987 The regulation of important oxylipin metabolic genes in peripheral blood mononuclear cells varied with the extent of change in arachidonic acid concentrations in the case of PTGS1 and ALOX12 regulation.
26562384 Origin of the Enigmatic Stepwise Tight-Binding Inhibition of Cyclooxygenase-1.
26339385 Immunohistochemical expression of COX-1 and VEGF is associated with poor prognostic parameters in renal cell carcinoma.
26245672 variable turnover rate represents the most convincing determinant of the inter-individual variability in response to aspirin for primary prevention in diabetes mellitus
26067486 Significant associations with NSAID-exacerbated respiratory disease were identified for: ALOX15 homozygous genotype and PTGS-1 rs5789 A/A homozygous genotype
25988363 Data suggest that, in organization of enzymes in post-translational endoplasmic reticulum, mPGES1 (microsomal prostaglandin E synthase-1) is likely co-localized with COX2 within a distance of 14.4 A; mPGES-1 is localized much farther from COX1.
25972361 over-expression of COX-1 in an aberrant manner intersects multiple pro-tumorigenic pathways in high-grade serous ovarian cancer
More...

AA Sequence

MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTI      1 - 70
PGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWES     71 - 140
FSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFK    141 - 210
TSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPP    211 - 280
QSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQ    281 - 350
LSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA    351 - 420
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAEL    421 - 490
EELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKT    491 - 560
ATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL                                   561 - 599
//

Text Mined References (238)

PMID Year Title
27522738 Does COX1 gene polymorphism (A842G/C50T) influence peptic ulcer bleeding in Indian patients?.
26870959 2016 Association of PON1, P2Y12 and COX1 with Recurrent Ischemic Events in Patients with Extracranial or Intracranial Stenting.
26703471 2016 Different Fatty Acids Compete with Arachidonic Acid for Binding to the Allosteric or Catalytic Subunits of Cyclooxygenases to Regulate Prostanoid Synthesis.
26672987 2015 Changes in PTGS1 and ALOX12 Gene Expression in Peripheral Blood Mononuclear Cells Are Associated with Changes in Arachidonic Acid, Oxylipins, and Oxylipin/Fatty Acid Ratios in Response to Omega-3 Fatty Acid Supplementation.
26562384 2015 Origin of the Enigmatic Stepwise Tight-Binding Inhibition of Cyclooxygenase-1.
26339385 2015 Combined use of COX-1 and VEGF immunohistochemistry refines the histopathologic prognosis of renal cell carcinoma.
26245672 2015 Aspirin for primary prevention in diabetes mellitus: from the calculation of cardiovascular risk and risk/benefit profile to personalised treatment.
26067486 2015 Genetic variants in arachidonic acid pathway genes associated with NSAID-exacerbated respiratory disease.
25988363 2015 Relationship of the Topological Distances and Activities between mPGES-1 and COX-2 versus COX-1: Implications of the Different Post-Translational Endoplasmic Reticulum Organizations of COX-1 and COX-2.
25972361 2015 Aberrant over-expression of COX-1 intersects multiple pro-tumorigenic pathways in high-grade serous ovarian cancer.
More...