Property Summary

Ligand Count 332
NCBI Gene PubMed Count 242
PubMed Score 1641.28
PubTator Score 766.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma 1.100 3.4e-03
astrocytoma 1.700 1.8e-02
Astrocytoma, Pilocytic 1.400 2.9e-07
colon cancer -1.400 1.1e-04
cutaneous lupus erythematosus -2.000 1.4e-02
cystic fibrosis 1.241 3.1e-04
ependymoma 1.200 7.3e-07
esophageal adenocarcinoma -1.100 2.1e-02
Gaucher disease type 3 -1.100 3.5e-02
glioblastoma 1.300 6.2e-04
group 3 medulloblastoma -1.200 1.2e-02
head and neck cancer -1.300 1.3e-02
interstitial cystitis 1.200 1.3e-02
invasive ductal carcinoma 1.637 1.1e-04
lung adenocarcinoma -1.200 1.2e-08
lung cancer -2.300 7.9e-05
lung carcinoma -1.300 3.7e-17
osteosarcoma -1.635 1.0e-03
ovarian cancer -1.300 1.2e-02
pancreatic cancer 1.200 1.7e-03
pancreatic carcinoma 1.200 1.7e-03
psoriasis -1.700 1.2e-03
subependymal giant cell astrocytoma 1.321 2.8e-02
ulcerative colitis 1.300 1.5e-03

Gene RIF (232)

AA Sequence

MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTI      1 - 70
PGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWES     71 - 140
FSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFK    141 - 210
TSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPP    211 - 280
QSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQ    281 - 350
LSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA    351 - 420
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAEL    421 - 490
EELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKT    491 - 560
ATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL                                   561 - 599
//

Text Mined References (247)

PMID Year Title