Property Summary

NCBI Gene PubMed Count 83
Grant Count 40
R01 Count 22
Funding $4,098,559.38
PubMed Score 96.25
PubTator Score 114.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (38)

PMID Text
25661773 Study identifies a novel fibulin-1D variant, named fibulin-1D', comprising 638 amino acids with molecular weight of 70.5 kDa. Fibulin-1D' lacks a secretion sequence, has a truncated N-terminus domain and binds to the intracellular domain of integrin beta1.
25456503 Extracellular matrix biomarker, fibulin-1 and its association with soluble uPAR in a bi-ethnic South African population
25331251 The purpose of this study was to develop and characterize robust quantitative assays for the emerging cardiovascular biomarker fibulin-1 and its circulating isoforms in human plasma.
25234557 fibulin-1 expression is associated with NMIBC grade and recurrence, it is epigenetically down-regulated and functions as a tumor suppressor gene and angiogenesis inhibitor in bladder cancer.
25014213 Increased levels of fibulin-1 were independently associated with higher levels of suPAR and NT-proBNP especially in patients with lower aortic valve stenosis
24739800 Treatment with low-dose spironolactone reduced plasma fibulin-1 levels in patients with type 2 diabetes and resistant hypertension.
24084572 Mutation of fibulin-1 causes a novel syndrome involving the central nervous system and connective tissues.
23907575 FBLN1 functions as a novel candidate tumor suppressor gene in CM, and its downregulation may be due to promoter hypermethylation.
23866070 Plasma fibulin-1 is independently associated with pulse wave velocity in type 2 diabetics.
23391467 Fibulin-1 is down regulated in renal cell carcinoma through promoter hypermethylation.
More...

AA Sequence

MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKECRMVQEQCCH      1 - 70
SQLEELHCATGISLANEQDRCATPHGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVF     71 - 140
QACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSD    141 - 210
GVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQ    211 - 280
NTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEE    281 - 350
GTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG    351 - 420
SYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTG    421 - 490
GHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPENY    491 - 560
RRSAATLQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTVISLPTFREFTRPEEIIFLRAITPPHPASQA    561 - 630
NIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVNVHIFVSE    631 - 700
YWF                                                                       701 - 703
//

Text Mined References (85)

PMID Year Title
25834989 2015 Fibulin1C peptide induces cell attachment and extracellular matrix deposition in lung fibroblasts.
25661773 2015 A novel intracellular fibulin-1D variant binds to the cytoplasmic domain of integrin beta 1 subunit.
25456503 2015 Extracellular matrix biomarker, fibulin-1 and its association with soluble uPAR in a bi-ethnic South African population: the SAfrEIC study.
25331251 2015 Total and isoform-specific quantitative assessment of circulating fibulin-1 using selected reaction monitoring MS and time-resolved immunofluorometry.
25234557 2014 Fibulin-1 is epigenetically down-regulated and related with bladder cancer recurrence.
25014213 2014 Extracellular matrix biomarker, fibulin-1, is closely related to NT-proBNP and soluble urokinase plasminogen activator receptor in patients with aortic valve stenosis (the SEAS study).
24739800 2015 Low-dose spironolactone reduces plasma fibulin-1 levels in patients with type 2 diabetes and resistant hypertension.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24084572 2014 Mutation of fibulin-1 causes a novel syndrome involving the central nervous system and connective tissues.
23907575 2014 Abnormal hypermethylation and clinicopathological significance of FBLN1 gene in cutaneous melanoma.
More...