Property Summary

NCBI Gene PubMed Count 82
PubMed Score 677.23
PubTator Score 500.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.600 0.000
lung carcinoma -4.100 0.000
non-small cell lung carcinoma -2.000 0.000
psoriasis -1.600 0.000

Synonym

Accession P23141 A6NIM1 A8K3K8 A8K844 E9PAU8 P82127 Q00015 Q13657 Q14062 Q16737 Q16788 Q549X7 Q549X8 Q86UK2 Q96EE8 Q9UC52 Q9UDG8 Q9UK77 Q9ULY2
Symbols CEH
REH
TGH
ACAT
CE-1
CES2
HMSE
SES1
HMSE1
PCE-1
hCE-1

Gene

PANTHER Protein Class (2)

PDB

1MX1   1MX5   1MX9   1YA4   1YA8   1YAH   1YAJ   2DQY   2DQZ   2DR0   2H7C   2HRQ   2HRR   3K9B   4AB1   5A7F   5A7G   5A7H  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
463149 other 3 / 0 / 21 Late stage assay provider results from the probe development effort to identify inhibitors of PME-1: Fluorescence-based biochemical gel-based ABPP inhibition and selectivity
588807 other 12 / 0 / 31 Late stage assay provider results from the probe development effort to identify inhibitors of PME-1: fluorescence-based biochemical gel-based competitive Activity-Based Protein Profiling (ABPP) inhibition and selectivity in a complex proteome for ABHD10

Gene RIF (53)

PMID Text
26657071 The structure and activity of glycosylated and aglycosylated human CES1 has been determined.
26340669 decreases of CES and CYP3A4 expression and enzymatic activities induced by Fluoxetine are through decreasing PXR and increasing DEC1 in HepG2 cells
25704243 CES1 c.428G>A single nucleotide variation increases clopidogrel active metabolite concentrations and antiplatelet effects by reducing clopidogrel hydrolysis to inactive metabolites
24563511 CEH is an important regulator in enhancing cholesterol elimination.
24350812 study found an association between two CES1 SNP markers and the occurrence of sadness as a side effect of short-acting methylphenidate
24212379 After oral administration of dabigatran etexilate to humans, DABE is hydrolyzed by intestinal CES2 to the intermediate M2 metabolite followed by hydrolysis of M2 to DAB in the liver by CES1.
24170778 The conversion of 2-oxo-ticlopidine to M1 was further confirmed with recombinant paraoxonase 1 (PON1) and CES1.
24141856 CES1 plays a role in the metabolism of several drugs.
23936796 PMPMEase overexpression in colorectal cancer and cancer cell death stemming from its inhibition is an indication of its possible role in cancer progression and a target for chemopreventive agents
23658012 carboxylesterase I controls RhoA methylation
More...

AA Sequence

MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQP      1 - 70
AEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIH     71 - 140
GGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGG    141 - 210
NPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSA    211 - 280
VMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGI    281 - 350
NKQEFGWLIPMQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL    351 - 420
IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEI    421 - 490
RLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPP    491 - 560
QTEHIEL                                                                   561 - 567
//

Text Mined References (90)

PMID Year Title
26657071 2015 Comparison of the Structure and Activity of Glycosylated and Aglycosylated Human Carboxylesterase 1.
26340669 2016 Fluoxetine reduces CES1, CES2, and CYP3A4 expression through decreasing PXR and increasing DEC1 in HepG2 cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25704243 2015 Carboxylesterase 1 c.428G>A single nucleotide variation increases the antiplatelet effects of clopidogrel by reducing its hydrolysis in humans.
24563511 2014 Liver-specific transgenic expression of cholesteryl ester hydrolase reduces atherosclerosis in Ldlr-/- mice.
24350812 2013 Methylphenidate side effect profile is influenced by genetic variation in the attention-deficit/hyperactivity disorder-associated CES1 gene.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24212379 2014 Identification of carboxylesterase-dependent dabigatran etexilate hydrolysis.
24170778 2014 Multiple cytochrome P450 isoforms are involved in the generation of a pharmacologically active thiol metabolite, whereas paraoxonase 1 and carboxylesterase 1 catalyze the formation of a thiol metabolite isomer from ticlopidine.
24141856 2014 In vitro drug metabolism by human carboxylesterase 1: focus on angiotensin-converting enzyme inhibitors.
More...