Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P23083 A0A087WSX2 P01744
Symbols V35
IGHV12

Gene

PDB

1WT5  

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MDWTWRILFLVAAATGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWI      1 - 70
NPNSGGTNYAQKFQGWVTMTRDTSISTAYMELSRLRSDDTAVYYCAR                            71 - 117
//

Text Mined References (9)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17947238 2008 Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528.
17576170 2007 Immunoglobulin somatic hypermutation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
7681398 1993 Nucleotidic sequence analysis of the variable domains of four human monoclonal IgM with an antibody activity to myelin-associated glycoprotein.
6815656 1982 Cloning and sequence determination of the gene for the human immunoglobulin epsilon chain expressed in a myeloma cell line.
2841108 1988 Dispersed localization of D segments in the human immunoglobulin heavy-chain locus.